SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235263|estExt_fgenesh2_pg.C_sca_620033 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|235263|estExt_fgenesh2_pg.C_sca_620033
Domain Number - Region: 22-74
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0691
Family Growth factor receptor domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235263|estExt_fgenesh2_pg.C_sca_620033
Sequence length 515
Sequence
MDVHERIHCLNITRFNLTGGHLENQSVACISCFFPQNCQPDNQCLPGTTGLTCESCDQTV
SDAKYFLFGNSCIPCEKIPWTAVTLGLFLLIVLIGFFLQGFTPQYVTKLKIMIHFFQLLI
SSIHVKTNWPPSVIKFISIIGFGKFTASVVDLRCMVSTTKDKLYIEWLTALCIPTIIIII
GLIINNREEKTLLKLRKHQKDKEKEEMIINSRLKLRRFLYLIVIIYLMPIIICIIRSFSC
TSIFDEGMVFRLSSRDIFLYDNTFTCDSIIFQTMNLLLFFYLIACLVFVLFCLIIFPLRQ
NKWDLLESQENEYGFVYESYKKRSCVWDALPKFRILISLGLTDTLLLHPVYQSIGVCCLT
VSYLLLLLLARPYRCFFWKYTSCNNHLILDILCNIGIVLLQTGGLLTSLNLYPSYLDYII
ISVICIVIIYWVILMLAVRFEKQSFLLVEISANRVNASQVSVTSESVTNTNYRQVSSSST
DTLELHQTTAKRKVSTRLKSNKVANITRESESFDF
Download sequence
Identical sequences V3ZVL1
XP_009062622.1.39240 jgi|Lotgi1|235263|estExt_fgenesh2_pg.C_sca_620033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]