SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235311|estExt_fgenesh2_pg.C_sca_630002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235311|estExt_fgenesh2_pg.C_sca_630002
Domain Number 1 Region: 70-296
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.96e-47
Family Nuclear receptor ligand-binding domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000346
Family Nuclear receptor 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235311|estExt_fgenesh2_pg.C_sca_630002
Sequence length 302
Sequence
MDVSNRRFCKRCRLRKCFEIGMRKEYILTEEEKTRKRMRIEENRREKEVEKFRHQSGDVT
SSNNRLRPLDPEEQQAINELITAYQQSLEICVDNDISRNNPSMTDLVNIAEISVRRVIDM
SKKIKSFKALSQTDQISLLKGGSIELLIIRSVITFDREKQHFLDPYDNGKYAMTAEQLKM
GEGSGLFDEHMKFVKSLAMDLKADETVLILLLVISLFSPDRPSISDKTYIAKEQDKYALL
LQHYLESKYPVSYVRTIYPKLLMKLTDIRNLNEEHSQVLLKVNPEGIQPLMKEVLDLNVN
KL
Download sequence
Identical sequences V3ZV75
jgi|Lotgi1|235311|estExt_fgenesh2_pg.C_sca_630002 XP_009062719.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]