SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235372|estExt_fgenesh2_pg.C_sca_630109 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235372|estExt_fgenesh2_pg.C_sca_630109
Domain Number 1 Region: 35-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000131
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 2 Region: 354-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 286-317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 4 Region: 153-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000183
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235372|estExt_fgenesh2_pg.C_sca_630109
Sequence length 422
Sequence
MSNTSTVDTPRKFKIQFQILDKYELKVGHVDENLGASVGWVKSPNFPNGYAMNGETFSFL
LQNLDPYGHVRVVFDDWDIAPDSQVKVYDGLNIDSPSIVLNLNNRPVILSESNTIFIVFN
TGTSKLPCCQYSGFKAAYQFVSEKVWTEQPVTDCSKIYPMKSGGTIEFSGLASAFPTYFD
CVWIIKREIKTDNQPDGVVLRIGEVLLGDGWIQYSKSNNLEIRDGVTSEGKLLNKYTYEN
LSDVSPISTTSNGFYIRLRGSFYSTDKLNFIYTTYKNVTQEGCPGYYDFLCSNLLCIDQE
LMCDRVNHCGDGSDEIPILDCSASALWKLSFKWSVPDFIGELSTIKSIKTERPCYRGFMC
VSGRECIAKSKRCDGIRNCIDGSDEHRCYARAANSSQHNFQLNSLLILILLLLLFINKYV
IC
Download sequence
Identical sequences V4BDH0
XP_009062817.1.39240 jgi|Lotgi1|235372|estExt_fgenesh2_pg.C_sca_630109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]