SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235814|estExt_fgenesh2_pg.C_sca_700058 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235814|estExt_fgenesh2_pg.C_sca_700058
Domain Number 1 Region: 26-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000101
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 2 Region: 150-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235814|estExt_fgenesh2_pg.C_sca_700058
Sequence length 238
Sequence
GIGVFLASLSLACAYIPSVYYLNEKCNTQIQFSNDVRIKLTRYSYTNLRRSLNCQITIST
RDVSDKLLLRFRSLDTRTSFGCTTNKLSIYDTNGNILSGGGICGGIRPSKVYETTGSSLK
LLFNTDSFTRQTGNFDVLITSFNNGNRNGSCFAGDYRCENKRCIYNGLTCDGYNNCGDDS
DEIDGCGLSKGVFIGIGIGGFVFLVLIILGIICGRRRYYHHHCHGPTITTTTKSYQNF
Download sequence
Identical sequences V3ZRY9
jgi|Lotgi1|235814|estExt_fgenesh2_pg.C_sca_700058 XP_009064019.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]