SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236088|estExt_fgenesh2_pg.C_sca_740077 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236088|estExt_fgenesh2_pg.C_sca_740077
Domain Number 1 Region: 151-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 27-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000119
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236088|estExt_fgenesh2_pg.C_sca_740077
Sequence length 284
Sequence
MLKFLILCTLISVYCSTVSSYTDTEYVNSNCGSTVYVTSATKLKLENYMFYGLDSPCEIT
LTAYDSFQTGLSLEGHFLDFDLPCNYGSVTLYDSTNRQSRTILADQLCGYKPSTFYKGSG
ESIVIEINKNEGYSQYTASFNFLLTESHDGFCDDTEFQCDNFECINNLLTCDGNNNCGDN
SDEGSVCFWTIGTIAGIGIGGGVLFMIVVIIIAVSCRRKQRVVYQNQYGSMPYTNGPQVI
AQPYMVMPQPQYGAAPFPGYQQQTPAPPAPPAYKQEQPKTTVKS
Download sequence
Identical sequences V3Z2R5
XP_009064498.1.39240 jgi|Lotgi1|236088|estExt_fgenesh2_pg.C_sca_740077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]