SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236092|estExt_fgenesh2_pg.C_sca_740086 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236092|estExt_fgenesh2_pg.C_sca_740086
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-48
Family Astacin 0.00017
Further Details:      
 
Domain Number 2 Region: 279-388
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-38
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 598-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-38
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 4 Region: 434-545
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 726-818
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-29
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 6 Region: 164-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 389-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000198
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 541-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000491
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236092|estExt_fgenesh2_pg.C_sca_740086
Sequence length 837
Sequence
MRHWENHTCVIFVEKKPEDQNYIVFTERPCGCCSFVGKRGNGAQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRTDRDDHVQIVYKNIMPGQEYNFNKLTSNDVNSLGEEYDYGSIMHYA
RNTFARNTFLDTILPRRKPGVLVRPDIGQRIQLSPGDIRQAKKLYRCPTCGRTLQESAGR
FRHDPKTGLGEVCQWRISATHGEKIVLNITRLELPVSYNCQTDYIEVRDGYYIKSPLLGR
FCGDKIPETMVSTDTRMWIEYRTNNGLGKGFVAEYEAICGGEIVKDTGHLTSPNYPDEYR
PNKECEWKITVPEKYSVALKFQSFEIENHDNCVYDYLEVRDGHEDSSPLIGKFCGYKIPE
DIKSTGNKLYVKFVSDGSVQKAGFAASFVKEYDECKTDLHGCDHNCENTLGSFKCTCNIG
FELHSDGKRCEDACGGYIKAQNGSLQSPSFPDLYPPNKNCVWQIVALHQYRIMLNFTHFD
LEGSNQDCEYDSVRVSSGTGKDSTLHGVFCGSTLPTPVTSEGNVLRIEFNSDNSVQKTGF
KSMFMTDKDECAEENGGCQHICKNNIGSFECACDNGYTLHENKLDCKEGGCQHEITVPSG
EISSPNWPQFYPSRKDCVWHFTTKPGHRVKLEFEDFELEPHQECTYDHIIVFDGDDNSAR
SLGRFCGGDKPEPIISSGNRMYMVFYSDASVQRKGFHAKHDSVCGSHLVATENLQDVYSH
SKYGDQNYDNRAKCEWTLQAKEGFRIHLKFTAFEIEDETDCSYDLVEIRDGIKDDSTVLG
RYCGSAAPKEIISSTEYLMIRFKSDDTINWKGFHAVYSLAHPAQIDYDLKELDTEFN
Download sequence
Identical sequences V4B875
jgi|Lotgi1|236092|estExt_fgenesh2_pg.C_sca_740086 XP_009064504.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]