SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236136|estExt_fgenesh2_pg.C_sca_750076 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236136|estExt_fgenesh2_pg.C_sca_750076
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily Prefoldin 2.88e-26
Family Prefoldin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236136|estExt_fgenesh2_pg.C_sca_750076
Sequence length 127
Sequence
MAAKEGPTGVDLELRKAFQELQSKMITTTQQLKISDAQIETLKRQITHSKLVTKEIEALP
SETRVYQGVGRMFLLQPIPQIQKNLDSKIKASEEKIKSIDTNKGYLERSIKESEDSLREL
VLSKKGR
Download sequence
Identical sequences V4B7Y7
jgi|Lotgi1|236136|estExt_fgenesh2_pg.C_sca_750076 XP_009064586.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]