SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236238|estExt_fgenesh2_pg.C_sca_770084 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|236238|estExt_fgenesh2_pg.C_sca_770084
Domain Number - Region: 74-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236238|estExt_fgenesh2_pg.C_sca_770084
Sequence length 139
Sequence
MNNLSCSVLLISVILILVDADCSTYPNVTDANFEKDCDGNVIISCNKDFKMVQGLECVEE
EWRYQNPICKRTEIVNPCKNNGTVLSDGSCNCTEYFGGTFCEEMRCEMLEYQDCKSECKR
GQDEMNEYCDDGLFCCYYG
Download sequence
Identical sequences V3ZQ18
XP_009064798.1.39240 jgi|Lotgi1|236238|estExt_fgenesh2_pg.C_sca_770084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]