SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236413|estExt_fgenesh2_pg.C_sca_810019 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236413|estExt_fgenesh2_pg.C_sca_810019
Domain Number 1 Region: 382-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 2 Region: 279-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 53-108,237-271
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000661
Family Fibronectin type III 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|236413|estExt_fgenesh2_pg.C_sca_810019
Domain Number - Region: 338-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00544
Family Laminin-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236413|estExt_fgenesh2_pg.C_sca_810019
Sequence length 533
Sequence
MSKIKLLIVLVIYLSPEFVDSSKEIRYKTAKPAVGSLPSVNDILKEQRLILKPPSKLQSF
LTSSNNIYLVWDAPEVYKIHDVNSNDTFWDEDNTTMSLIDDNTTETTTVDNVTTKPTGVT
SVDIGTTSESPFEKGDNTSIMSRNICRPYVFLYNRTRPGDYAHIVKKPSEVATHAMKVEE
NDENNENMTEITINISEAVAPFSQGCVEQYTIYIYNNETGELAQSKRLGGNEPTEINITE
LKPSTTYKLLVGAEFTSRHKLNSTSITVTTKADQDKKDCQCSGVGTIGGHQPCRKDNTSL
CICKPGYSGLFCEVCQPGFYKTAMFFPCHPCPCRQYSSVVSYCHFKEGFLVCDKCRSGYT
GNLCHQCANGYHRYKGKYCVPCRCHGNTDSHSDSVCDPYTGACISCTRNTTGFNCERCRD
GYRGDAINYKNCTAISDLDKDLLPLPAGYIAGIVIAVILVLSFILAFIVYKWWKFPTMKP
FWTVELKEDHEGVSFSAVDDQEFLKATETRNKEGQFYEKQGRGMKYAQLREDV
Download sequence
Identical sequences V3ZS57
XP_009065518.1.39240 jgi|Lotgi1|236413|estExt_fgenesh2_pg.C_sca_810019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]