SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236519|estExt_fgenesh2_pg.C_sca_820106 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236519|estExt_fgenesh2_pg.C_sca_820106
Domain Number 1 Region: 165-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 53-153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000497
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236519|estExt_fgenesh2_pg.C_sca_820106
Sequence length 472
Sequence
MESLKAVVLTAALTPTKYMVKYCSSSRSTIHINSSLILKLTDDPVEDRTSVGFLHCATSL
KTDRHSSIYLHFIELDIAHQSSTPDRLHIYDFNDDGKKVQLTPSKGIYGVFQKPYYTTNT
VDSPIRDYQSSGNKFRLDFLGKPTYMYKGFAILLTKVKDARYNGCKKGYFHCKHQDICIP
GELQCDGQDNCGALDGSDEFNCAGLEETVTNLLSSYSVYHAVIAAAVGILVFLASFMLIA
YCIRKYNRRKYPFVKARALLQRGMCTVTTNLDEERLYAPPSYEDVVANSNGGMPGSSRGN
EPPPDYSEYIRTTLNKRRDLTDSEDEDSEYGSPQRENKLNDGMRSRFVNLHDEFQDINPQ
MNTKGKGGKPKRSSNKTNSTRKFETHDHPSTADDHRDQASSTSASDNVRTGTPSSHGSTI
SLGFPQTGDDSENDLKSGDSGIENSSERISKYNNNVKSTAREATPNKDTVKN
Download sequence
Identical sequences V3ZHK6
XP_009065714.1.39240 jgi|Lotgi1|236519|estExt_fgenesh2_pg.C_sca_820106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]