SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236865|estExt_fgenesh2_pg.C_sca_880076 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236865|estExt_fgenesh2_pg.C_sca_880076
Domain Number 1 Region: 21-210
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000146
Family Calmodulin-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236865|estExt_fgenesh2_pg.C_sca_880076
Sequence length 220
Sequence
MAGNPVPRSPNRLGGYLTRKQEYIFNLLYDTMHDKNLSRQDFKELQKRMSDLRNLRPASE
ENRKLQTRIGSIWSGLMKSSRHYRKNPLQQHLNVPEWLAYWSDFVKSARSVRGWPEVSED
GLTDYQWHNEFIDLIFDNMDYKGDESLDKEEYSRFMKAFGLSTDRCEETFLSIVNNTKNG
QKIDRQKFKDLWFEFLTNEKEDGVGNFLFGNPLLELVDET
Download sequence
Identical sequences V3ZG24
XP_009066273.1.39240 jgi|Lotgi1|236865|estExt_fgenesh2_pg.C_sca_880076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]