SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236952|estExt_fgenesh2_pg.C_sca_900076 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236952|estExt_fgenesh2_pg.C_sca_900076
Domain Number 1 Region: 5302-5511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000534
Family Fibronectin type III 0.0046
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|236952|estExt_fgenesh2_pg.C_sca_900076
Domain Number - Region: 5909-6006,6504-6583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000129
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 52-136
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000279
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0089
Further Details:      
 
Domain Number - Region: 249-525,690-821
Classification Level Classification E-value
Superfamily ARM repeat 0.00158
Family PBS lyase HEAT-like repeat 0.042
Further Details:      
 
Domain Number - Region: 7208-7266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 4458-4486,4814-4912
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00996
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236952|estExt_fgenesh2_pg.C_sca_900076
Sequence length 7473
Sequence
MYSNLKVSYINVGETAHGQEIFLRVRTFSFSGANSPHMVGHDLDLNKWFSFVINEHGEIQ
DVFYDKNEEDEIVAIKKGMAAMFAGKLHDEDENLMEKTPEGWRYHVQEVGHEGQHNATYN
VEPHSDGKKFTKTKNEHPLAHAKAQYTKTLYFNSELGTIHTVHVDEKFSAMKQTVPGYEP
FEGQRPTKPSNDFSDIEYPEMKAMGKGKLEFLSQHKISDKPSRSSLQTVQDSIHIKTVKA
KPIRSHEPEKILEQIRANLTIMRNQPDESATQEMTNCFHHLMTCLNLLDDDNFEKLLSHY
LALNPLSRRNEKDRNHILDAAMGTDTERAHDIITEKVLDTNKPDVKLIMRLMVHIISSDE
VPSQKLLTRLFELAFEKNKSQAVLHKGDVYHRILLTVGSVSRKLHQSGRSQEAADAISKI
EKMIGYHDPYMYRKKRSIMKEEQILAEDSLKVNLLGALGNARLDQSYEYIVSHINTTNCQ
WVKRAGITALRGYHHDHAANLMLNTAKYDGDDTVRYEALLQYQAHPRAKKLTPYIPPVAR
NSSYNESSIYFNPWDLDSQEASIHSRHRRSFIDEGFTFILQSPSVDFKKMLGSTKIGASF
GVLMKNLLDLKISALSGHAIVDVHDEAYARVHLGVVGVNLDFFLARVCFKGNAEYNLNLL
QEFGIDNLKDLVKLYDKIKNEVVGEIKKGIDLFKKIIRGDISIGQILEEFKQALEQLPEK
VVKLGKRAIEIMKRLGEIDESELPPFIRSIRKLVTKVVTIYNDVRKDVMGFYNKLLETIT
IVIPRAGKQIYAAIKAIIEAFKDFKNDPKKAISTVGGNVLNVGLEVKNLIDAVNKTKDAC
FFLKKEKPYWFNLKKQYQEIKDLTKQVKIDMTSGSRNWIQQKFVGKDPVAELTNGKYSMA
ELRQEVIDELKSILDDLLEPFDGIRNLGGEFFERFMGVFKLVDTIKTSYNTLKEGYRTAR
SLIDRVFGPKCHKDFPRKYRIKGGGCDGSGFYVSELKKGGVAEYPIDGVDVVASRGSKLV
APFPGNIRRSTRSNEVIIATTGGSLKDTEIIITNVEPNSTIPSENDVPLQVHAGQIIGKV
TSTPCSAVDFIHFAMRKTTDGGIIDPTRYLEARVPNLPKWVQECDDYRLIWKFDLIAEGS
ILGPNGKENVTETPERSGPTINQPINLDDQDDPAKVLDGGLFGDDTMFGKASSPAKKSEI
DEKTAKTKDKGLANLFKRPAAFLQKFSIRKLKMGAILDLLDILGLDESKAAMAEVILKIK
EIIDNKPCFNPYQMTDDQLRTELTERGLSAEGSTKTMIQKLTAPNKKCAAMSLNMPTDRM
FCTFDQHCLGIECCAHLKVFMFLKTYKIFARFDPCDLMFVFGIKDVFEKKIGPFGGLYGN
QELVVKPGVKIDLLGGMELVITVIIEKTDSVALGTLGVTFCSIEDEDNCLPSLNILDETI
LPLPVCAPDGSFTWPDVNWKEYYSRDAIKKRLKESAKKLAEEGIEYGIKEGLKELGIPEE
LLEETPPCQRPEILTDTLLKNQLSELGLVTTGTLQQLRDRLSNSHKTCTILDKTLTLPTI
KNEKLKKLIYLRISQNCLHLQACIDVKIRSKLFNFTKAFNAYIELDACNFLLHVGFETYK
HSIVLIGYEWGKEEELPLGKAINLKFKIDKDSNKKVFIVDFGVLINLGDEESSIDSKMLE
GMEIPIPICNENFTLPGGGSIADFAKEMGGKLSEAAVEVIFQKLGLNKIFDEGTCNVPPS
PTDCPWNIDVEKYLPAKVKDKVTCGMPDDCFGVNCCVDFQFKIPFIDDPVVKSVFIYAKF
DPCDFRLDVGFGKYKHSEKLLTYQWGTPTKLKIGSGDPAPITLTLTINKYTQGFILDLSV
LACIPIDGSMFCFPEEGLDLMKDVRIPACDARALANLTDIDFSLEGYFKEIGDQAGQKLA
KSAAQFLLDKFGITPFLLDERCDVKREPYSSSIDGWRNDCPKPIKKLPKLPKGLICHIGD
TCTKIDCCFDVAFLDMSFHAFLNLDMCDYFLEASIEKKHIKYSLFNDEYNLDTGITGEVK
ISDFFVVTFGVRKVDKKFLLDLSIKVCFEKDKCQENYPILTGTEVPQFICDLNAKLDFNL
KNFSIADWAKEKGMDIADGLAKKAVQVFLEQTGIAEKMLDPPCKRDSLQYQPALPSNWKN
DCPKITTLPELKAPANCYIPDYCTGIDCCLESDLLGISLNAHLNIDTCNYVIEGAIEKIG
FKIVILEYDWGTEEEEKLSEFVFIKFKIDRLLEQKMFIVDLSIKMCFKGADSCEIDLPVL
QQSRIPMPLCNMEMGFKIKDFSLKNWLEERGGDLTAILANQLMDQLGITKYLKDTPCSFV
QEPFKTASVNDGWNKACPLNMTLPALNDRMACYIPEYCTGITCCVDVREIRRTFQAHLFI
DTCNYIFSVGIEKIVYNVTLVDYVWGTEESIDIGGIFQLKFRIEDLPGEKQYLVNLKMSA
CFTAGEKCDLEIPVFTDMRVPKLLCDWDATLALKDFKLDEWLAEQGGQLTDTIIDKLLEK
FGISAYLTSPMCDRDGSIYAPAVQGWKKDCQLNMNLPALPSDLSCQVPDFCTGIDCCLQV
PFLKRSFRAVASINMCTNVLTLSIEKIKLQKSLINYNWGQPDSFNLRGVIRVDYVIYDLA
GDKQYLLGLNMSVCLSSDKPCQPTVTVLNNVRIPKLFCDWDATTDLKDFSLQKFLEEQKQ
NLGDALSELTFSRLFEALNISQYLIRPQCNRAGDVYSPANAKGWKYDCPIQTLDFGKLPD
YATCRIPDFCTGIDCCVTVPVIGRSFNVKVYLNACDYTLTVSLENLVFKKTLLNYQWGTR
EQFNINGVVGIEFVIDNLEGARQYLISVSATFCFDSTTACLTVPILNNARVPKILCDWES
DYSLKDFSLSTWLEEQGMAAANELSSIVLARLFNELNIAQYLKDPQCDTTTGVYTGAVGG
WKNECPLITNLPPLSNGLTCYIPDTCTGIQCCAPVPILKRSFEAFIYLDSCNFKFRVGVE
KYEFSRNLINYEWGTKESLSMQKLVTAQFTIDDLNSEKKFLVNLNISICLEKDKPCFLSV
PVLTNTKIPKLVCDWDSTLALKDFSLSDWLENQQAAGIQSLTSALRAKLYEELGIAMYIK
SPPCLKSSSVFSPATSKGWKNECPISEVDSLLPQLPDNFRCHVGSRCTNIDCCIDVGFLD
TSIYTLVDVNMCDYTLTLTIENLSYEHKLFDYTWGQPSHFYLKGVVRVDYVLSKIDAEKS
IEVSVKISVCLAENDCLFEQQILDKKRIPQPLCNYKESLELSSFSLKHFKLREQLPSAAQ
IADIFLTKLLEETGLADYLQQPGCDRESAPYIPADSKNWRKECTKSITLPSLPDSTRCHW
SADCSTIDCCIYVGLIKRTVNLKVEVDVCNLELTLKLGKMEYVISLFDYEWDKEDVFHIS
GRVRLYYKLVNLPAENKIKTDLNIKVCFEDDSCLLDVPILQQVDISYSPCDITKPQAFKG
LTFDFWSFKSCQLKTPPSSCPVTLPAAISNICHLADNCQGISCCMGVDLKYLGQYSLAAS
FKLDHCQNKLTYSLENKQWEKTLLPIATDTNITEKIGEAIDISYVIKDVGSAYVVSVDIK
LCALNTYQNIPYCKFWSLLDEESFVKPGCTKRRKRRSVIKVTTEDQYEATLKDLIGRDAT
NKEIQDFMNEVKNDADTKIETNLFPDWEDGGQANTIRSALKSMGSTNPSTILYRSDNGKV
TVGMEGSEEVFKILNTMSGVIDDVEQAFVVGKGLTGAGLKLLGAKLANMTIGEIMTLVDT
KNIDPEKALELVKQIRNLASALYSEVLDAVLSGQAADTFKSLDFTLQGDFSFPKQNVVLF
EYSIYFLLAGIVPMNFRFGAGCTYGMQIIVGGKIMKMVAFGGATPYGAVLTFGELNVGFI
LYGGLRLEGYIMTTSFPTRAEIGFSKFPLDIGLTMDLELVPLRLRLLAIVTLRVKIGFIK
FTKTLFKATLWKYSTPTIRKRLIDFGKVEEDTSPPLFAEYTDTKSGRRKRAAGLPINTAT
RHCSVRQLKGRDHTEPAIEISIRAEDDKSQVKLFLTAGSKPGLADALSETQLGGPSSIIT
TKLKQHGRPIYFTVVGRNSGGGSATVTCSLPTYDVSLPGGRFTTEFVTSSNPRVLKASVV
VFEDSDLEYSSVGVGLGRGIYGDEMEHWNPIDLKVQNNKAYDAAADTHGYEAEAHFTTSK
LGRLIAPVAQEFNGINYYQACLKKCLELPESKCLSVNYELTGHCELLEAIEGHDYKISTS
GKYLHMERLGVGLAYEFAYSDKQLQHNKLYYFNFDLKNHLGFRNIISTKGILIDTTTPTP
GEGLFNATTDELELVTCRKVIPKDRTDWAARCIDQSTLVKNHRTMIDGEGSNTVFNGHTP
LLDKKYFRANRYMSGNWDGIHDKETGIHGYSFAAGHSICEETLDEHKDPHAHLYDESEWT
HTGIIKRDENDPIPDGKYYLTVRALNKVEYGGPLVTSFCHSTPYVIDNSVPFVHEVFNVR
YDEESEDLSAEYNATDPESDVREVDICLGRTTKDCSIKDWERYPHSGEVIHNTELPGGIP
VWVKIKAWNNVNISALRSADHPLILDITPPIAGKVYDGPLYKHDLMYTKDSNKICANWVD
FYDPESGLSYFSAYVRASANDMYLTNGTDFDHRTHQACIDLDDGVLEHGKKYYIELWAYN
AGHKQLNVSGRSDGVTVDLTIPVTGEVVDGIKPNMEDIEFSAATATISGQWKGQYDPESS
IKSYEIQILRAKNISQDFEVLRDWHELDNDTQSIEWHNFHLHHRDNVKLKLRTTNGALGR
IVEETDGYVVDLTPPSLIYLNDGGQQTKDIDYQSSKDSISVNYKFIDEESGIDHYKYQVY
QLFQGSKHQIYPADGEWIDVKDATTDNVKVTSIALKNGARYSVRMSAVNKANAVATFDTN
GFLLDDTPPEMRWLHVGVFNGEIEEDIDGEVLQADKTGIKASWFATDDVSGIKDYSVAVG
TTPGGQDILAWKSFSNKRDGYIDGLNLQIKTASSPYYYVSVKAENGAGLESGVITSTPIK
VVDEDKAGIVLDGAEGTEGSPSVDIDYQLETGTVTVQFSGYESALHGISRFDWAVGTTAG
GEEVQPFMEASLIHKEEADLPGNGIASSGYGQAILPQESGVKYYATVRGISNIGNVLEST
SDGFTVDISPPSITVQSLSEVSEKMKLEPGMKIYQAEVDSISADWLVQDLESNVTKMFYS
VGTYPDGADIKSAAEVSVFLNGEGSLPVGDAKPTADGKPNIINFWAVNNVGLTGKVSSAT
LIVDTTPPSEGVVTCPSFIQPHTSMKCSWDGFIDNESPIVEFTFGLGSREGTTDVIAPVS
LPGYTTLHLVDNLLGGVTHGKKYFAIVTAKNAVGKTISAVSDSISVDVTPPVVGQVVELR
TEYIINVTSDRSTSELNTHSCNSKDDCDKIDAVCQESLTSINVAWSQFTDPETKIVRYEI
AVGTTPGGGQVKQFFTASLDKRYMTIKNLALNGLKQVYVTVKATNAAGLSTVATSNGVYI
SYVSQGKEPLKPIGVWDGDTLDGDINFQTSLDTITARWDVTGDPCPAMKLEWSIVRIDGL
VVQNFTEILGSQVAVNDKLSMKNGERYYVLLRVTTSSGYSYILRSNGVTIEQEPLIPGQV
NDGDVVGFDLNKIYTQNKASANWGGFGIPLNGDSAPVEIESGNPGVGVTGENKNQEILYY
EVALGKDRRFPKTRDNVVPFTNVGLNTSVTFFDLKLLPLTATYYFTVRATSKSLAVAEVT
SNGFQAGYNHGVLAASIVMPEYIKNNTVIDIQWNEFQSKVGMMMYYIAISSNNTVTEDQC
RQFIEGGDMTEEGRKKVFDIRDVENVGKDTFKQLTDRILEQDHGYYATVIGVDKAGDCNL
TTFAFHVDITPPVKGLIKVGPYYGMKMSYAASSESVTVDWKDYIDDESGIKCFRVSLIEQ
STCETGATRTTIVKPIEINGNYTAYEFLGLYLQPSRPYIVHLEVENNAGLKIKAETAPVI
YDTTKPTGGHVVDGTNFRQDVVWINSLSTVTGSVLYLPSPDGPSCPSRNIKFTDSSWKRF
KAEQNYDSKGNRLQLEYRDGNVLTNPDRDNELEIKLARDVKTDTMFTGGYYRDADMVNGG
TYEVNLQAADGKGKAVTSIVLWDGPESVIVEYDYTKEVDWTLGVCSCCKVDPNDNECLKV
CNCKDFLEARNIVKRSTGANDTNKPDYVKDLTEEQRAELMLEETAGDTGDVQAVQIPSYR
SCGIQILAGDAQKLITWCRFKDNLNQPMKAERKLTFDPSASVNNYRLEFNILQEEATGGT
WCLNVYVNDDEISELCGIPELSVETKLFLHVWNWKNYLPPLPTKVEDMFELWSTKAIFTD
LIMPPESNAICRLGRPFRGGKNAVVKFEAGIGTRVNSDNVVPFREVTRPCIPCQTPCDRF
ECLPPCNSQKVTQHNLKLNNLELNATEIVNGTEKAIHYHFTVKAVLGSGMSVISSSNGFY
VDVTPPEVFEETFLYIDVYQGNFTPVSYQASNDTIRSIFLCEDTESLIVEYQWAIGTTPG
GLDIQEYVSTGINPSGTNRNLLGILEDNSTYYVSVKCRNGAGLETVYNEQKGVTVLLNAP
DIADINTNITGAEPFTEKVSPPTAMKSTDPSSIGCSWTVSADPSIREYDFGVGSTVDPCD
DIFPFTWVGYNVSGEVAIKDGWLQINGEKVEPIGAYNPNQTDTNDTSTATTGYKMEPGRT
LFLCMRMCNEARRCTVRNVGTSIIVDANSKMATSTNGESVEVSLGSSTGRKKRAVTDVVI
KTPPGLQPGQTIMETELTTVQLEADYRSDASTEFISYITNPATTLTQSRYLHRLLLNRLN
PNAGDKSFSVTSVGNLPMPGPLEFTIKYNPATTDADKQPMLIHWNPAKSIWELSKRTCKN
EANTEIVNETTGEIKIKVCDTWSSDETVTTRTKRAVGKDAYFKRDTQFMVTDVLRKIPNT
PPQLAPDVPRQFTMIEDEGTIVYQLKVVDPEGDEVVYSFGSTPSASLGSVNLTAKGLLMY
LPCKDCSGEIEVPVKITEVQSEEIPPEETEETLKIVVTEANDAPTVFALKKDKSLLLSDP
TETVVLLMEQNRLGLNDSHQYSWTFGVYDVDTSDKLRLFIDRPKNGSLTISPGYENTPSC
GIEAKESSLPCNRMSLPHPVNQMKWLYYTMTYEPEEGVSGYDDIRMFITDDAGTSSDVVS
IRMAMMMMPCLNGGTCQPKSSDATYTCENYRRAESFDDHYSCKCADGWVGSRCQDDYDEC
TSSPCSWPYVCYNYENRYECACSQDEPNCDGLVGWMIALIVIGVLLMMAIIALICYICMV
RRGRVKWSKFFNRYGSNNSNHSSDDDKKQITFDNNAYNLDNEEEYPRSRSGSSQMVMFNR
RYQYDGLNGPMREQELIGVPSMNSSPASSGINGNGRKASSSQGSHFGPSTFEMSRSSPKG
ERLPQVRLVTPPREQFEVQTPYKETVPYPDYID
Download sequence
Identical sequences V3ZES3
XP_009066786.1.39240 jgi|Lotgi1|236952|estExt_fgenesh2_pg.C_sca_900076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]