SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236958|estExt_fgenesh2_pg.C_sca_910010 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|236958|estExt_fgenesh2_pg.C_sca_910010
Domain Number - Region: 333-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000172
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 537-578
Classification Level Classification E-value
Superfamily Gated mechanosensitive channel 0.0418
Family Gated mechanosensitive channel 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236958|estExt_fgenesh2_pg.C_sca_910010
Sequence length 592
Sequence
MKTAPCTASRDSKPYCPCGVSVRVGREVFVIERCAPLKYWRIEYLQCSVTGFKLIDIKRS
GNNYEFKLPSGLIMKTSVYQQRQFINLYLYPSQTDTVATGLCGQVGSDIFYKRDRTTVAH
VNYPGMPDFSSSWSVPDANIDLFSDEIKLLDPVETGGFFCKCTTPVGSTEPQFTCEKSDD
TCAVTIGSSESVDQCIVGGLQSKRSIKSHRSRRSADNLKKGRKKRAQANTELTWRNGWNE
TTATNYCNKLFDNSTFVGKCKTIPNVDLSFPRDNCVQDIKFMGDTSFALVAIETIVNQCI
REVTYDSTYHSPPNGETTSLLEAIKDVACPLDCSYHGTCNKGVCTCDSGWAGNDCSMDIS
IVPVVDHIANEGYCDLNDRSCDAISVYGGDFIDDSSTLCKISSYQIMDNGDFGPKSEIEE
PSIVKSIGEVQCGLGKSRKKRSTRSQPGNEFVKVYSVSVSNNGEAYSNSSLVVIFNSMCQ
FCTITAANDVQCNYTGDFCISEGTCYGNGEPHSQHTCYTCSVENGAREWVKGGDCDDDML
WIIGVVLGVVLILVIIAILVYCVVKKNKTQVGSIDNKTSPPPYKSGVCLFIL
Download sequence
Identical sequences V3ZEG6
XP_009066815.1.39240 jgi|Lotgi1|236958|estExt_fgenesh2_pg.C_sca_910010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]