SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|237829|estExt_fgenesh2_pg.C_sca_1190004 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|237829|estExt_fgenesh2_pg.C_sca_1190004
Domain Number 1 Region: 81-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|237829|estExt_fgenesh2_pg.C_sca_1190004
Sequence length 339
Sequence
MCLGELKYFLYMTNYVLPVISSSEFTENILTCSVLAIKGGYQSFFYHQQNHQCILQSEKI
HVVSDLSVSDGYRYLVQDGPTCGPPPTLGNGQLVSVSQVNGDYVAEYSCNTGFYFSGTKT
STCSGGIWSTGMNCKSLSTCKDLQDCNPSYTDGEYWLYPAVLNQQKVRLYCYGMTTQSPK
EYLSLSGNNFAHFPNGRYTNCDNLDSSNPQGMGKTEFTKIRINPQDLTVLNDDYQFTSQD
FGSQRPYGVAKACSDGFGCELRGVAKLDISNTGLKFSSNNVWKAVGNNPKKVIKSRTDYF
IHVTGDGSCGGAEPENPLKLEIDVSTPPVEGSATLPACT
Download sequence
Identical sequences V4B6F3
XP_009046161.1.39240 jgi|Lotgi1|237829|estExt_fgenesh2_pg.C_sca_1190004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]