SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238307|estExt_fgenesh2_pg.C_sca_1400016 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238307|estExt_fgenesh2_pg.C_sca_1400016
Domain Number 1 Region: 273-307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000432
Family LDL receptor-like module 0.0031
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|238307|estExt_fgenesh2_pg.C_sca_1400016
Domain Number - Region: 227-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0511
Family LDL receptor-like module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238307|estExt_fgenesh2_pg.C_sca_1400016
Sequence length 313
Sequence
MKILVSIVLCAVFLLVNVKEGSGIFDKHGKSEAKNYAISQEFSGFYKNILDKCNEIQDVS
RFLCKTGNSSCCALFSAADFCVGKCEDNGINTQANILELFEAITLESCVELVAAYGNCQT
PSSECTIIKLFLEICVIKFPLLVSPITSPITSQITSPTTSPTTSPLTSPITSPLTSPITS
PLTSPVTSPLTSPVTSPNTSPLTSAVTSPLTSAVTSPLTSPVTSPITSRPAGVFYCDVLG
SGRVQMPVSVWCDDTVDCNAHIEDEQAANCNGCIMGQFKCGASETTCQPATNLCNGMQDC
ENDFDESSRICAP
Download sequence
Identical sequences V4B5A8
XP_009048125.1.39240 jgi|Lotgi1|238307|estExt_fgenesh2_pg.C_sca_1400016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]