SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238308|estExt_fgenesh2_pg.C_sca_1400017 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238308|estExt_fgenesh2_pg.C_sca_1400017
Domain Number 1 Region: 961-1229
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.63e-53
Family Protein kinases, catalytic subunit 0.0000155
Further Details:      
 
Domain Number 2 Region: 795-879
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000122
Family Fibronectin type III 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|238308|estExt_fgenesh2_pg.C_sca_1400017
Domain Number - Region: 110-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0737
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238308|estExt_fgenesh2_pg.C_sca_1400017
Sequence length 1245
Sequence
MDITFYTFYRKYTNHSHLHVLILDTTLKKPMMIQFTKSLVVLTVIIVCVSAWSGNVCSRL
KCISKWKKICSYRSWLGCCAYRYTWVTQYTRERFCCKGWTDRNRNQNCNIPKCRPRCKNG
GTCTAPNQCQCKPGYKGPTCTGVTCSHLKPCYPGMCTGRDQCQCDSGFTGNTCLVRRNFP
EQRTQIWLFRSTLKSVQRTTMMMNYEFVLESSNPNEGADESIWSNHLDLNYFIVESLGQF
EPNIDSQRPSYVRSADFGVVESTLTLTHTKIPRPGETVKPDVKTYPCSSRTNDNIPGIWN
CTVMEKNFKMKIESGDELRMTMLFKSGGTRELVILGGNKFYRSETFNNLTSSKSIVFKFD
KDAPTHCQSDGSCNDNDAPLEVNDLTKTGAEIRWGGWRDEQLSGMFRYAVEIFKLEVVDS
EGRLGEKKPLNPLQISEYMHANFSSVLPIRYTPSEPGMYSVILEASDRANNSRWARRLFL
YDDRSEIELKSNITVPFAVQPDSNSVWLSTLDSDLEIVWSGHFVNPLHVENNLLNEVKDY
PNQFSDIDPKMGDFKIKRVTFDADSGTRSKSAVRNIGGIVNFDFVLETDDITIRKSFLQE
KHTIRNSELPDRSDGSSFKLFITAKDILSNSKTDNKTIRFDSSPPVMSDLIWEDNLPVPT
VPIRRPKRQTGDSFASRILVEASDKNSGIHEIRWHISRRNTSVAIWEDVRNGSVAGIRLQ
SCEQKTSCYCISGVGCFDTEHVVNLNMCWFSVARAHINTASAKVTIDAVNPAGLSTSKDI
QVMKLESLLKKSYFAPVDNIAVQNVGSNFVTIEWNSTKSCLPVSEFWLLRSDRREKEKVH
RLRHDYEIAPLDPDSNYTIQFISGYDGEMSDPVYITFRTGHAPSVLSSGGAEGLSAGLIA
LILLVLAVVGALYMKGFIGNRRNNKKRLHEYESPKRTRFDGNEDIYVYGFAGGNLNLPTG
HVIGGSNLILQELIEQGKFAKIYKATVLGNDGDKSEVAAKMLLDNFSDDERHLMGGKITF
MSDVITGHDNVLKFIGAVTDNKIWGPTMVIEYCENGTLISWLHKNKNNVNDDVIERLYQI
SFGVVKGMTYLASLNVVHRRLAARNILLTFILEPKITGFGPSVIDSENGEKERVAIRWAS
PECFSNTKNATEKSDVWSFGIVLYEIFSLGDKPYPTLTNNEVIPKVRSGFQMNRPEFSDQ
FNYDLMLKCWQLDQIQRLSFEQLRDQYHVFMNGEEQTEGYSNYKY
Download sequence
Identical sequences V4AV45
XP_009048126.1.39240 jgi|Lotgi1|238308|estExt_fgenesh2_pg.C_sca_1400017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]