SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238419|estExt_fgenesh2_pg.C_sca_1450020 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238419|estExt_fgenesh2_pg.C_sca_1450020
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000166
Family Growth factor receptor domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238419|estExt_fgenesh2_pg.C_sca_1450020
Sequence length 413
Sequence
MATFDLKVIVACTIIIVLTHIQFGTCGECLPGYMGNDCNDTCSVTCQTINDDIYCDQITG
RCTYGCIDGTFGDNCTDQCPEHCKDMICDRESGECSRGCEIGYYTDDCSKICSKSCENSA
CVGIDGDSKFTCSDGCSEGFTGADCSTPCLTPNCAMCTDASTCERCQKGFYGTTCDHTCK
RRTSNCAECERSSGECVQCMPGYFGSACDQSCSNCYGGKCTIAGLCVEQCTKGYRGPFCN
QSCPKNCEDYVLDGVNVTCNKANGLCARGCLKGFYGDKCNLVCPINCPESHCHQIDGVCM
GEECLNDHYGNKTICDRYNGSCLYGCVSEWFGAVCMTPCGINCLPVSPLVNRTASNAKCK
GSGRCPFGCQAGWKGVQCDIKTNDPTSISRLFQPSFYGIVTIVLIPLVLSVLQ
Download sequence
Identical sequences V4AUF8
XP_009048381.1.39240 jgi|Lotgi1|238419|estExt_fgenesh2_pg.C_sca_1450020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]