SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238591|estExt_fgenesh2_pg.C_sca_1530030 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238591|estExt_fgenesh2_pg.C_sca_1530030
Domain Number 1 Region: 84-140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000278
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|238591|estExt_fgenesh2_pg.C_sca_1530030
Domain Number - Region: 191-232
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000122
Family Anti-platelet protein 0.044
Further Details:      
 
Domain Number - Region: 49-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00025
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238591|estExt_fgenesh2_pg.C_sca_1530030
Sequence length 261
Sequence
MMVNANLMLMVVFLWAGTLPVASPKNYPFMLKRQTPDCEKYVLPINAMWEPTCDENKRYK
CKKGYESIVQTTCENGGWTLEPACEAVGCPQGEIITLSDDVTESSIVGGLFHFSCSVGFV
ETGTLRCEENGTWTEQKACQVVLKAVVNGNKMDERYRINNCTEECATTPKCGYTPGVHGI
CDLYRKPVIFIYYNTARVSECIQKCKDEPRCLTIFYESLLEKCYLYNTDFTTITNTDGLA
VVNDEPGAIVEKSGFDFVNTP
Download sequence
Identical sequences V4AZ26
jgi|Lotgi1|238591|estExt_fgenesh2_pg.C_sca_1530030 XP_009048978.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]