SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238708|estExt_fgenesh2_pg.C_sca_1620023 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238708|estExt_fgenesh2_pg.C_sca_1620023
Domain Number 1 Region: 71-151
Classification Level Classification E-value
Superfamily SEA domain 0.0000288
Family SEA domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|238708|estExt_fgenesh2_pg.C_sca_1620023
Domain Number - Region: 199-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000556
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238708|estExt_fgenesh2_pg.C_sca_1620023
Sequence length 431
Sequence
MNKMDAGSLTPGRLTVILTLSIIIGLISSTLGGSSTSNSAQNFTSSLTQRLTTPIQITLQ
PGIIKPKIDVKNYTIQLKIRTSETFRAELINNTSELYQNYTKASKTVLNELYKNILGFNA
IVIKSFSNGSVICHYEVLFNLRVTSRNGITATYIHDIIIQKIKLSKILKNLPGDFDVAYF
DAQMTKFSKSDAAKRLTDPCFDACSGHSQCEMINSPEVIKCSCKEGFKGEDCRDVDSTIT
VHDRIIIIVSSVCGAIALILIVMICMCLCNRNKHKGSSQELYSRDSLYWSRKWRENSFMK
SKNRAYKPEADRAWRSMDNNFGDRAEQKVGDMDRRYEKPSRDSYEMVYSPSRSIYGRHYD
TTQRPARDFDETDLQYKQIRDPYSHSGELMIYQPTRSPRVNADLRVYSDYAAVAPKYQAN
PYEEQRHSREV
Download sequence
Identical sequences V4AXN7
jgi|Lotgi1|238708|estExt_fgenesh2_pg.C_sca_1620023 XP_009049520.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]