SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238820|estExt_fgenesh2_pg.C_sca_1730005 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238820|estExt_fgenesh2_pg.C_sca_1730005
Domain Number 1 Region: 295-388
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000131
Family Mannose 6-phosphate receptor domain 0.0085
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|238820|estExt_fgenesh2_pg.C_sca_1730005
Domain Number - Region: 171-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000275
Family LDL receptor-like module 0.006
Further Details:      
 
Domain Number - Region: 137-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00183
Family LDL receptor-like module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238820|estExt_fgenesh2_pg.C_sca_1730005
Sequence length 388
Sequence
MSRDLVKIQNGCAHILIDDVKRMKNALDLSEMKIKTCFFRRLFRRRKYQTLLLLVFIALC
FFFLQFFSMRKLSIWNRLRADEEFLNIKQLSDIDDEEVFKEKLKMAEETMQKQQESKALL
NGVHRKDEKFYRPDANGSFTCLQDKIKIDFSQVNDDFCDCPDSTDEPGTNACPHSKFYCK
YQIPNEEAVLITGSKVNDGICDCCDGSDEYAGHMVPAIYIILDKIFLKKYSVFQTPCQNR
CQKGLEVKAQSERVRRIGTKLKLSYLEAGKKATVRSAYGPENVFFKLSSQCFTLEKTIYE
YKICPFVSVTQVDFPQATFNLGKTPQWLKQVKGDYSLLMKNGDNRLCPEGVSRSTKIRFF
CGLQDLPLSINEDEKCTYIVKFMTPAAC
Download sequence
Identical sequences V4AZJ7
jgi|Lotgi1|238820|estExt_fgenesh2_pg.C_sca_1730005 XP_009050126.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]