SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238999|estExt_fgenesh2_pg.C_sca_1830001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|238999|estExt_fgenesh2_pg.C_sca_1830001
Domain Number - Region: 706-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000283
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 563-613
Classification Level Classification E-value
Superfamily RNase A-like 0.0942
Family Ribonuclease A-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238999|estExt_fgenesh2_pg.C_sca_1830001
Sequence length 781
Sequence
MWLLLYICIGLSLWYTASCQNVSDICKFHSPFSYPDKRLITHNHNSKLSDRFLRAGWYGK
EEHMIPSEPPGAGQCGTKYPIYLQERPPNSGAVETVTACVQADDECQQTIEIQAVVCSPT
LTVYKLARPSLNGASYCLAPSIEGEFPDFKTKTIIEYKLKDVALPDNSNKTRKEYTFMCA
FEDPDDVRLVYKTQWFVDDESVYDSPYTDYKDTDGLRTLTDTRLNAGGITTAGFQLRCEV
RPGFTAHQSRIAGLPSRSPSKFIGIEVLNSVITISEGATATIYIRPSVEIGCREKEGCEL
SVTADIPNVEENEKQCQPTAVANGGCGVIIETENWNVNRNLEISSTTTEEFGQDSIQMKI
FLRTDDAYFSQPLWANYFLTPVTINIQKNTTLIEGRKCGVHNDPYVDDFKGRRLTLQLEG
TYTLFRSERNVEIQIQTEDCSGVRTGYCVCGVVVRVGRTAFMVNRCNLGYWYIDYVLCDD
GADILDVRKRSETYFQMYLPSGSKVDLSLRKSGSLNWLNIGLFPSIRDVGKTSGLCNELN
ADINKNDDLMETIPFFNQWRVKKEQNMFIPEDYDSIEGIDTSGTFQHCRCNDHDATGAVG
KLNCTRINSVTPCVQDTDYTMFHKKRCISPLRRKRSVPGFSQSNIIRHKRLKRLSGTEAF
ALSSISTVSSQCLYEARMNRTLREEKVEDSKSLLELVKEVSCPGECSDQGRCAKGKCICN
TGYIGSDCSVSLNEPPLAHNLEAEGHCDLSVDDCTEVAVFGGRFVEHEKTKCQLNPFEVN
Q
Download sequence
Identical sequences V4A3V6
XP_009050699.1.39240 jgi|Lotgi1|238999|estExt_fgenesh2_pg.C_sca_1830001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]