SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239000|estExt_fgenesh2_pg.C_sca_1830002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|239000|estExt_fgenesh2_pg.C_sca_1830002
Domain Number - Region: 609-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239000|estExt_fgenesh2_pg.C_sca_1830002
Sequence length 845
Sequence
MLFMFFKLRCEVRPGFTAHQPPIAGLPSRSPSQFIGIEVWNSVITISEGGTATIYIRPSV
EIGCREKEGCELSVTADIPNVEENEKQCQPTAVANGGCGVIIKTKNWNVNRSLEISSTTT
EEFGQDSIQLKIFLRTDDAYFSQPLWANYFLTPVTLYFNIKNSVYNVLMINIQKDTTMIE
GRKCSATGDPHIRDFNKRNLELQLQGTYTFYKSEGNVEVQTQTEDCSGKGTAYCNCGVVV
RVGRTAFMINHCNLGYWYIDYILCDDGANILDVRKRRETYFQYRGHDLLDIDIFPSIRDV
DKTSGLCKEINAHLNKNDDLVEDIQFINRWRVKNEQNMFIPEDYDSIEGIDTSGTFQHCR
CNDHNATKIVGKLICTPINGVTPCVQDTDYTMFHTKRCISPLRRKRSVPGFSQSNITRHK
RLKRDYDSIEGIDTSGTFQHCRCNDHNATKIVGKLICTPINGVTPCVQDTDYTMFHTKRC
ISPLRRKRSVPGFSQSNITRHKRLKRDVSWKNGWTIKRADEYCTDLFNNSKVIDRCKGMK
GLDINIGIKTCVQDIQLSGTEAFALSSISTVSSQCLYEARMNQTLREEKVEDGKSLLELV
KEVSCPGECSYQGRCAKGKCICNTGYIGSDCAVSLNEPPLAHNLEAEGYCDLLVDDCTEV
AVFGGRFVEHEKTKCQLNPFEVKEVKITPRGNVIVKTAVFESIGEVTCKLPSRKRRRSID
VPVIDETVTGYKVSVSNNGENYSQQLNFIIYNTECMNCSMDTESTQCVFSSDYCIMDSNC
YRNGSIYNNGEDEYICNAGGKSKSWDIILKPDEKGDNHSVNGANRKSLAVLQDKAPQKWN
EKPID
Download sequence
Identical sequences V4C9Y0
XP_009050700.1.39240 jgi|Lotgi1|239000|estExt_fgenesh2_pg.C_sca_1830002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]