SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239013|estExt_fgenesh2_pg.C_sca_1840016 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|239013|estExt_fgenesh2_pg.C_sca_1840016
Domain Number - Region: 55-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239013|estExt_fgenesh2_pg.C_sca_1840016
Sequence length 521
Sequence
MIRPPELFKIYQGLFLLLLIHSRHEVRGVTDTTLNPTTSLPPVRDVFLDPPGITCDSFPD
HCKNNGTCRQLLDDELWECSGDVGTGPLKCICPPTHTGSRCETKLTCDSMACLSTEVCDY
NWNKRELECIPKNTSGQPPTCRPGVQEIKFQVDRTNLPKKIVCLPMYSFNASSLCRDEDD
SLTYLISEPPPELPHLFCLVVDYQTYQTCLRINATHRDSINMTSVEVTIKAEEYSVLERS
APLKLRIIFNTPPSVQNSVIQWVVNTADTMSLDVIQEAQVTSQTELQISHFSLSNENIVT
ALITNKSFLQLSLKGTPTFEIKKLQATVKITDTGIPRLTTTVIIQITLVRLDCQPINTLL
IDKRNMVTVGTPFPVGQIECRGTTGYRLNYDSPQSGIIPGSSISVNSANEIMVKVNEALP
SRLPETGSSRLIVSFNKLRKVLNFDFEISYYSLIWFESEATKFSLLEIETEIIKHLSAKV
SIKFSRIRDVNWVDILLKSNVQSSYNYINYYIICRDRCKLG
Download sequence
Identical sequences V4A3T7
XP_009050744.1.39240 jgi|Lotgi1|239013|estExt_fgenesh2_pg.C_sca_1840016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]