SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239068|estExt_fgenesh2_pg.C_sca_1900010 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|239068|estExt_fgenesh2_pg.C_sca_1900010
Domain Number 1 Region: 41-127,159-409,527-638
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.79e-36
Family LacY-like proton/sugar symporter 0.063
Further Details:      
 
Domain Number 2 Region: 444-495
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000236
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239068|estExt_fgenesh2_pg.C_sca_1900010
Sequence length 659
Sequence
MSENDCVLVQQEVTVKETDAQCGVGSWKPKCLQKFNNPKCLLFFLCMYGMILSFVVNGIN
NVNTTSLERRFNLSSARVGMISSAYDISAAVLGLGISYFGSGKNKAKFLATAGLFMVLGS
CVMSIPHFSTGLYEAGERVIMLCHEENNSTEVCRTEETHLSNYLYVFVLGQMLHGVGGTT
IYTVGISLLDDSVSSSNTPLYIGILYCCSILGPGIGYIIGGQFLDLYVDFDVMDTSSLNV
TPEDPRWVGAWWIGFLVAAILNLIVALPLFLFGKELPSAKHVRETRISEAYGAEKSQTNP
VKIKRSLKHFMKVVTKLLKNPCFVFLALSMLTEGAIIGGSATFLPKVIEMEFRVSASLAA
IYTGIAVVPSAAAGQFLGGFVTRKLKLDIRGTLRLCILAMVVSLFGCSILWIRCSTEDIA
GINAPYPISPEFLIQDESVYIPDLTSECNKDCHCTTNIYNPVCDTDGLLYFSPCHAGCKQ
RSAVVNSSDYTMCSCVNSTEGIEEGRNIGRNAVWDTNCRKSCTILYVFLCLLFLLISFCF
LPIAPGDSVQLRCVNAEDKTFAQGLKSFIVRLLGTVPGPVIFGRLLDDSCVVWREECGRI
LSCWIYDHHLMIRNIFLLFVGTKILSIIFCSLALKLYKAPADNLNSPEEKVELETRVTT
Download sequence
Identical sequences V4A2S3
jgi|Lotgi1|239068|estExt_fgenesh2_pg.C_sca_1900010 XP_009051145.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]