SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239218|estExt_fgenesh2_pg.C_sca_2070016 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|239218|estExt_fgenesh2_pg.C_sca_2070016
Domain Number - Region: 31-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 64-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0457
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239218|estExt_fgenesh2_pg.C_sca_2070016
Sequence length 117
Sequence
MNSYTVSLSVLVFVACFSQISGQAACNLFPCVNGVCELNAAGVPSCNCYPGYKPIATIPQ
YCVDIDECLENPTNPCSPFRCCNEAGRFRCTRERTCQYRPKSSFNPLYLLLLRGGGK
Download sequence
Identical sequences V4ATK8
jgi|Lotgi1|239218|estExt_fgenesh2_pg.C_sca_2070016 XP_009052240.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]