SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239219|estExt_fgenesh2_pg.C_sca_2070017 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|239219|estExt_fgenesh2_pg.C_sca_2070017
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000551
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239219|estExt_fgenesh2_pg.C_sca_2070017
Sequence length 120
Sequence
MNYLFFSAILIASTATIYAQVNVPQCAGFQCISGTCNITVAGVPFCQCFTGFKPSNIISV
CEDIDECKQNNQLCQGFYCCNEPGAYTCSAHPCNQRNFNRRNDLSSLFFLLPFLGEAKKK
Download sequence
Identical sequences V4AJ36
XP_009052241.1.39240 jgi|Lotgi1|239219|estExt_fgenesh2_pg.C_sca_2070017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]