SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239554|estExt_fgenesh2_pg.C_sca_3140001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|239554|estExt_fgenesh2_pg.C_sca_3140001
Domain Number - Region: 22-74
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000128
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number - Region: 143-199
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00353
Family Hairpin loop containing domain 0.055
Further Details:      
 
Domain Number - Region: 85-129
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0051
Family Pan module (APPLE domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239554|estExt_fgenesh2_pg.C_sca_3140001
Sequence length 200
Sequence
MNNLLCSVFLLAVTTLILIDADCSTYPDVKNAYFNKDDNCVDVSVTCNEGFNMKQLISCI
DGEWKYQEPYCEPQDMTDCDYKYTNDTIVHTGYPKNLFSVKQTECNERCNTDTQCSTFVV
TDIRCVLYSPPVIAVLFNPIDGNYLNQCISNCSETKECLMFNYRPGGAVFCLLYNVTLDD
LSDGDTIRSNEFLVAEKTCQ
Download sequence
Identical sequences V4A8U0
XP_009056128.1.39240 jgi|Lotgi1|239554|estExt_fgenesh2_pg.C_sca_3140001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]