SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239614|estExt_fgenesh2_pg.C_sca_5160001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|239614|estExt_fgenesh2_pg.C_sca_5160001
Domain Number - Region: 68-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00456
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 28-62
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0301
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Domain Number - Region: 215-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family Laminin-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239614|estExt_fgenesh2_pg.C_sca_5160001
Sequence length 313
Sequence
MATDNIKIKFTGCSTYPNITDANFDKDCNGNVVITCNEGFKMVQGLECVEEEWRYQNPIC
KRTVIIPDCKNGGTLVEENGKFKCNCPLNTFGDDCNCRFKFTNATSLFPDPYAERLVSDS
AECDENCANDIRCSTSTMTYLKKCKLYETPVIFVSYDEDLCIEKCNEMSECKTIGTEMHN
YFAIFSNLQFLSLSPFVSLLVIIPDCKNGRILTAENGTLKCNCPPNTFGDDCKCRYKYSN
VTDLDPFAYEGISVSDSAECDENCANDTRCSAATITGASHIFSGFDGNVYVIATHILIDY
DNVIVSNSHFNRL
Download sequence
Identical sequences V4A0S2
XP_009060787.1.39240 jgi|Lotgi1|239614|estExt_fgenesh2_pg.C_sca_5160001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]