SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239773|estExt_fgenesh2_pg.C_sca_71960001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|239773|estExt_fgenesh2_pg.C_sca_71960001
Domain Number 1 Region: 59-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000139
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 3 Region: 119-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000129
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|239773|estExt_fgenesh2_pg.C_sca_71960001
Domain Number - Region: 173-212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00625
Family Complement control module/SCR domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239773|estExt_fgenesh2_pg.C_sca_71960001
Sequence length 214
Sequence
KDCGLPPPGITSTGFANGDNTATYTCDEGHIPLSGKAEISCLASGLWETDILICQPKDCG
PLPLGTLSTGFAKGGTKFPNTATYTCDEGHTPLSGNTEIFCLASGQWLTNVLICQPKDCG
LPPPGILSTGFAKGGTTFPNTASYTCYVGHTPFSGKAEISCLASGLWEIDILICKPKDCG
LPPPGVLSTGFANGGTTFPYTATYACDEGHTPLS
Download sequence
Identical sequences V3ZRE9
jgi|Lotgi1|239773|estExt_fgenesh2_pg.C_sca_71960001 XP_009064177.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]