SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|57120|gw1.958.3.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|57120|gw1.958.3.1
Domain Number 1 Region: 46-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000491
Family Growth factor receptor domain 0.0041
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|57120|gw1.958.3.1
Domain Number - Region: 1-71
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0706
Family Growth factor receptor domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|57120|gw1.958.3.1
Sequence length 219
Sequence
CNDGYWGIKCEKQCPTNCRLSKCDKNNGYCSECKNYYWGDKCEERCSVNCIDHPSITCYK
TSGKCNSGCKDTWYGDTCNNTCLDNCISCNNNQCTSCKTGWYGNQCKTRCNSNCINGCDQ
ATGRCTSCKAGYYGNKCTEQCINSCPGDCEEDSGHCKSCKSGTFGNYCNETYCPNGTYGL
RCSSTCGNCYNQTICHIVTGACDLELGCEAGFQGPTCKE
Download sequence
Identical sequences V3ZMV9
XP_009067142.1.39240 jgi|Lotgi1|57120|gw1.958.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]