SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|57932|gw1.68.19.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|57932|gw1.68.19.1
Domain Number 1 Region: 35-73
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 75-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 3-33
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|57932|gw1.68.19.1
Domain Number - Region: 112-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|57932|gw1.68.19.1
Sequence length 134
Sequence
SLYTCHDGTRIPLRYQCDGDNDCSNGEDEQNCNVNCAKNEKKCEDTTCIPANWWCDGEFD
CPDSSDEKQCPAIVYEPTGEFTCHDQSKISIQFHCDGSPDCPDGSDEVNCTHTCGPNQWK
CDYFDCIPVTWWCD
Download sequence
Identical sequences V3ZNQ7
jgi|Lotgi1|57932|gw1.68.19.1 XP_009063366.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]