SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|60418|gw1.3872.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|60418|gw1.3872.1.1
Domain Number 1 Region: 40-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000011
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 81-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|60418|gw1.3872.1.1
Sequence length 156
Sequence
EKTCRPDEFRCNNSLCISQALVCDTDNDCGDSSDEGEFSNHKCQPGFFQCDNKRCIPDHL
VCNGGLDCFDESDEYDCPALNCTGRRWTCKTVRQCISRKYQCDGVDDCTDASDEEDCATR
APDECHDNEFKCTVGGCIPETWKCDGQEDCEDGSDE
Download sequence
Identical sequences V4A9G3
XP_009057592.1.39240 jgi|Lotgi1|60418|gw1.3872.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]