SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|68388|gw1.213.20.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|68388|gw1.213.20.1
Domain Number 1 Region: 56-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000131
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 2 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 95-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|68388|gw1.213.20.1
Sequence length 132
Sequence
SCINGQFSCDGSNCSRECTAEEFKCVDDGLCVEKKYLCNGIFNCRDGSDEVNCSETRTCS
EEEFTCNNGRCVPMAFKCDGHNDCQDFSDEFNCKQCKDTEFMCSLTPLQCIAKQLLCDGH
DDCGEGTDEINC
Download sequence
Identical sequences V3ZYV0
jgi|Lotgi1|68388|gw1.213.20.1 XP_009052577.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]