SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|71684|gw1.55.104.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|71684|gw1.55.104.1
Domain Number 1 Region: 436-609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-34
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 2-164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-32
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 3 Region: 191-287,318-400
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-26
Family Laminin G-like module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|71684|gw1.55.104.1
Domain Number - Region: 610-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|71684|gw1.55.104.1
Sequence length 646
Sequence
PVTFKSSETYITLPTLKVQQAGVVSFKFKTIKDNGLMFYNKGSPTEPNFVAIELYDGKLY
FVYDFGSITRRVLFSPRIVSDGQQHEVQIRFFGRHIDLLLNGESKRINFVSGENLTDNLR
GAFYVGGYDSYTTLPWYVWSREGYQGCIQDLRINGKQVDLHALVKGQFLYGKVERKCLDM
PRECTQLQPCRNGFCIDSWDGYRCDCRGTRFTGRNCEKNALIGALDGNQVAIVSIDAPRT
HTNDISLRFKSPLKDALLFQTYTDVSNEYLRCELENGRIKVTTNLGGETKNTDINYSIKC
LHMQQTFRNTRHKFIRGLSISYYAGENLNDFQWHTVYINRRANQIEVWVDDGERVTGELA
GERYFFDIGQIFVGGLTDDRTAIGGDATNYIGYMQSFMFNDVSVFDTAKKPLSFNLTDIT
TLPPLIYNPVTIKTREHYVQLPTLRIPQSMVINLMFKTKETSGVILFNGGRNNEFIAVEL
YNGYLHFSFNTSDSAPALRMNTPQPLNDNKWHTVTIRRVDNRRFSVSIDGASTTIASEGR
DTSIDLQGPLYIGGLPENMFDKPYINSALLSKNGFQGCLASIDLSGAVPDLLQYSRGSTD
ISTGCTEIQSICGPNTCSNFGTCVPDGGLFRCDCNMTSYVGTICSE
Download sequence
Identical sequences V4BHG3
XP_009061258.1.39240 jgi|Lotgi1|71684|gw1.55.104.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]