SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|72310|gw1.82.87.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|72310|gw1.82.87.1
Domain Number 1 Region: 92-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000062
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 133-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 168-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|72310|gw1.82.87.1
Sequence length 207
Sequence
WQGVDCKEDINECDQGVCQNEAGCKNLPGEYECICQPGFTGNYHSLFCQYRVPGCPSNPC
QNGGSCVDTDSGYVCFCDDPYVGWTGENCDMDIDECSTSPCQNNGTCINNPGSYRCNCLD
DYHGFHCEISPICSSQPCKNDGACTEGFMLTYNCTCAFGFSGDTCETRDDPCTWTPCENN
GVCASDPVTFDYNCTCDETWIGEKCEI
Download sequence
Identical sequences V3ZHE5
jgi|Lotgi1|72310|gw1.82.87.1 XP_009065621.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]