SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|74578|gw1.25.254.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|74578|gw1.25.254.1
Domain Number 1 Region: 77-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000542
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 2 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000185
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 119-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000163
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 196-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 5 Region: 44-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000084
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 163-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000186
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|74578|gw1.25.254.1
Sequence length 222
Sequence
CTKRPCKNGGVCKNRFWGFECLCSHGFTGRTCECEIDECATGANACVGNSRCVNNVGREG
ITCKCPVGFTGHNCEINMDDCKSNPCLNKGVCIDGINSFSCECPYPFKGRLCELGRSWFC
KKRPCKNGGVCKNRFWGFECLCSHGFTGRTCDCEIDECATGANTCVGNSRCVNNVGREGI
TCKCPVGFTGHNCEINIDDCKSNPCLNKGVCIDGINSFSCEC
Download sequence
Identical sequences V3ZVA7
XP_009053783.1.39240 jgi|Lotgi1|74578|gw1.25.254.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]