SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|75059|gw1.70.82.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|75059|gw1.70.82.1
Domain Number 1 Region: 107-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 2 Region: 32-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 69-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 2-32
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|75059|gw1.70.82.1
Sequence length 142
Sequence
SCHGSQECIPSNNVCDGYGDCTDWSDERNCECNEYQYQCKMGMCIKNYQRCDTKYDCPDL
SDEENCTTDCPQGQYKCKSGICIMPEWVCDGLQDCGTTFDDEENCPECMPGEFRCLSGEC
IQASQRCDGVPQCSDHTDEKSC
Download sequence
Identical sequences V4B920
jgi|Lotgi1|75059|gw1.70.82.1 XP_009063960.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]