SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|75888|gw1.58.129.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|75888|gw1.58.129.1
Domain Number - Region: 130-251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00722
Family Growth factor receptor domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|75888|gw1.58.129.1
Sequence length 258
Sequence
VLVVFCMLLELLPNVEGKKKFPKCSVCKTITDDFKTGLDKTVKSNYGGGNTNWEEKALGS
YAKSEIRLVEVMEFLCKGGDKECHHLLEEHEELVEKYWFEEFGKKDNLDIYKWLCIEQIK
ACCPENTYGPNCIPCTGGAQRPCSGNGNCDGNGTRKGKGTCSCYHGYKGDLCDDCSDDHF
EESRNTTHVVCQKCDQSCKSGCYQAGPTGCEECNTGYELIDETCTDINECTSTTKQSDNL
SVCEEGKECVNNEGSFTC
Download sequence
Identical sequences V4BF75
jgi|Lotgi1|75888|gw1.58.129.1 XP_009061689.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]