SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|81462|gw1.113.67.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|81462|gw1.113.67.1
Domain Number 1 Region: 611-698,743-807
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000916
Family Mannose 6-phosphate receptor domain 0.0074
Further Details:      
 
Domain Number 2 Region: 230-369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 544-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000207
Family Growth factor receptor domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|81462|gw1.113.67.1
Sequence length 922
Sequence
EDFHYEYTECDSHGGRWRVSVPEPGKCIDGAPNAPVRGKDCSFTCKEGEYLDLEKQECEK
CPAGTYSLGGGLRFDDWEKLPSGFTITTEGFQGKFLWHNQGEDVNCSKSTWQPRGSYIAA
LPGDCTTILVFSTKLVKAGAVQFEYQYTDPDIIFHFMVQNDQCQAAGDDDASQWPKVTEE
GQWRKQSVNLKSGMNVIQWRTIGVLSDLSPSKQIPILIRNIEISGVAYTSECTKCRNGTY
SSGGNNFCADCPKNTFSHRGEGTCQPCDTAIQYSLPGATKCLIRPACKESDYFEHQTPCE
NKKTFKTYTWIKPENCNPGLVGSVKLPQSDKPTDCPPCNPGMHLVEDKCEFCPVNMHSDG
KEPCTLCPASTSPVYSIDYRWWNTMPPNITSTCLSMTDENCSEQVGWLTNGDHLQTNFGH
DENIFIILTLNIDGLRGSTGSVDGKAKVLGQISFMFDLDCEVGQCELVFLSNESGRNSIV
SSWQGTTNKQPYVHKIRTNKAVSFTWAFQPADWDTMDPDNIDISEYLNNKARIYSIQVTN
TLSGGAVACKACPRGTQKDGCIPCPDGNYIDPKTTKCTPCPSGTVMASGDPWGKQACEKC
GVGLKPVHGHHCASDCKITDSNGKTFDFSKLNGLQYVTGTRLFTSSGTTYFHGFNISLCD
NKVLPSCVNNVTSLDEEMFNEPSTVSGMICRSTMVPSKDKKTPNSIVSTQPVSIGDHLVQ
IVSNSSLKSQYIKEGFNSEKINDDIHFYFKSESATAACPNGRETIITLSCDVNEKGQGQL
ELPPKCSDGTCDGCNFHFMWYSQHACPLCQEKDYEVVNGECKNGEQTIHYYPPKNCLIPF
VSKPRKMVQKCSTLPLVVQISIPVAVGVGLLLLVLLVYCWKRNKKLEYRYMKLVETAGGK
DGELPAAESCGLDEGEDEDTVH
Download sequence
Identical sequences V4CMG6
jgi|Lotgi1|81462|gw1.113.67.1 XP_009045765.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]