SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|83086|gw1.116.72.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|83086|gw1.116.72.1
Domain Number 1 Region: 8-317
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-84
Family Bee venom hyaluronidase 0.00000184
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|83086|gw1.116.72.1
Domain Number - Region: 372-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0436
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|83086|gw1.116.72.1
Sequence length 393
Sequence
PKLEPTKPFSVFWNVPSFVCESRTPFNFTGSGITHNAKDAFIGDEDAIFYNLGLFPHLGN
PNVNGGIPQLGDLAKHLIMVESNVLKLLPNPMFHGAGIIDMESWRPIWVTNFSSLRKYQS
ASINLVKQQHPSWTNKTQINSEAEKQFETSARSFMLRSIEKVRQLRPQGYYGYYGYPRCW
GRPTGLDKTCPIGITSQINDKLGWLFSASNALYPRIYFNPVANSQDSIHNDIRRILNETA
RVQAKFSGLDAPILPYAVFQSGLHFFNETDLDLAIREPADMGAAGVVFWGSSSMFHIPNE
CAKMNDYIQHVLGPYIIKTEKFFQNCTQVNCNGHGRCIRKDYFQMAQENLRDGDHCKLKE
EEMKEIGNNKSNANEFKASYACRCFDGWKGSKC
Download sequence
Identical sequences V4B6Z6
XP_009045984.1.39240 jgi|Lotgi1|83086|gw1.116.72.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]