SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|86674|gw1.349.7.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|86674|gw1.349.7.1
Domain Number - Region: 1-88
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000157
Family Growth factor receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|86674|gw1.349.7.1
Sequence length 137
Sequence
CKSGYHGNKCDTLCPTNCNGGCIQNNGDCVACSDGYWGIKCQSQCPTNYKCEKRCSINCK
YHSSITCYKTSGKCNSGCKDTWYGDTCNNKYCPNGTYGLRCSSTCGNCYNQTICHIVTGS
CDLELGCEAGFQGPTCK
Download sequence
Identical sequences V4AGC9
XP_009056841.1.39240 jgi|Lotgi1|86674|gw1.349.7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]