SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|91191|gw1.16.482.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|91191|gw1.16.482.1
Domain Number 1 Region: 776-1113
Classification Level Classification E-value
Superfamily NHL repeat 2.33e-20
Family NHL repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 466-543
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000161
Family Pre-dockerin domain 0.093
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|91191|gw1.16.482.1
Domain Number - Region: 217-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 316-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00356
Family EGF-type module 0.086
Further Details:      
 
Domain Number - Region: 149-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00433
Family Integrin beta EGF-like domains 0.035
Further Details:      
 
Domain Number - Region: 343-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00789
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 185-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00963
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1823-1942
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.017
Family Thermostable phytase (3-phytase) 0.036
Further Details:      
 
Domain Number - Region: 1085-1160,1210-1324
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0194
Family Nitrous oxide reductase, N-terminal domain 0.029
Further Details:      
 
Domain Number - Region: 120-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family EGF-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|91191|gw1.16.482.1
Sequence length 2304
Sequence
VKLGQTIKYEIPPKSFWTTRLSKDKDGYLKLNFTLSDSAVLGVYGRRSVSPSHAQFDFFK
VFDGKRIQGRQKRSLSDTGMVEYLKAGTWYLAVYNDNNRKESVSFMADVTEIQTGCPGNC
HGHGECIKGQCRCFNGYTKDDCSQETCPVVCQGNGIYERGECKCHPGWKGQECDLKENEC
EVPNCNDNGHCINGQCVCFTGFQGPDCGIVDCVLPNCSGNGVCILGECVCFRGYKGRVCS
QDDKINITQVCAQDCSGHGVFDVEAGSCICDRHFTGADCQTEVCRLECYKGECKNQQCIC
EAGWAGALCDQVECDYRCKSHGFCNNGTCVCKKGWNGRHCTMDGCPSDCGNHGDCRHEAD
GWKCNCRDGWKGPDCHIAKEDKCSDTYDNDKDGLLDCLDPDCCSNAACRTSKYCETSPEP
MDILLTKQSPSTTASFYEKMRFLVEENSVQTYAMKNSFNETQVSVIRGRVTTKDGTPLIS
VRVGVVTQPLYGYTLTRDEGVFDILVNGGGSVKLEFIRQPFATKTASVLVPWNQIITMDT
VVMTLRNEPESMADPALCSVEHKHYLLRPVVLSTWQHTQLGACPERSTIIPESQVLQESL
PISGTDVHLVYHSSESPGYMSLILIQMTPATIPKLLSLVHLKVSVDGVVTEKVFEADPNL
KYTYSWNRKNVFNQKVYGIVTARVNVGYQYQGCEYIFWETRSTTLNGFDLTSSEIGGWNL
DIHHTYNFQEGILHKGDGTNIYLKEKPKKIINILGTGERRQLDCNGCNGKARDNKLLAPV
ALASGLDGSLYVGDYNFIRKLSPEREEIASILQMSTKNVPYTFYMTVSPVDGKLYISDFM
SHKVIRVKTMGPVRDLTENMEVVAGNGEECTPGEADLCGDGTVATLARLRYPKGIAINKD
GVIYIADGPNIRRITSDGVINTLIGTQEQLRKWTPMPCDDILPAESVSLKWPTALSIDPL
DDTLHILDQGIVLKLTKDYKLVTVAGRPVYCPPRQISFLPAGVLTDDEQASNVADHVTLV
SPSTITFGPHGDLYIVESDTHHINRVRIVTTDGRIHHFAGTKSKCDCQKACKCYDAKERL
AAQALFSTPTSVTVTPDGILHIADLGNQRIFSIVSELPQQNIHREYQVVSPETQEIYIFN
RYGQHKHTINIMTSQFMYNFTYNVNSFYGKLTKVADTSGNSIEVKRRYDTRVEKLVTPSG
DKCDLLLDNMRRLYRYTAPDNTTATFTYMASTGLLESKHTSYGKVFMYKYDDKGRLLQIS
QPTGEITQLTTDVNTTGSIVHVTTDSSDVVAMATYGSSQFLKMSSTQTKVTYLPDGAVIV
LFPSNLTVAIETGGHPIMENEHRMHFKRKVIVPDAYMHRMEWRFYLRRKGRSRHSRVIEK
IGQRMRINGENLLTVEYDRNQHMETVMDKDLRELLTIIYNKAGLPTHFFPATGHNSMNIT
YSSLGDITKWQYGEMVEERKYNAKGLLIERMSTNGAQFRYFYRFGAKKVYVIFPSGKQYL
FHHDTEGNLQQVTTPVLGKHQFHTVLSVGIQRLKYTPPGKTLPFILDYDTNGKLIRVIHP
GDTKRVYYRYNNHFQVSTILFDESEISYTYNSEAQRKASSELKARGYSCKLRYEYISSLV
KSYTVQFPLDLTLLDMNFTLIYDNNFRLAESLATLSNNLSMRNVISYSSVTGKLNRIKDI
NIEWTSNEREIFSNIDFRITREYDNYGRLQDVKMEFDGNVRFMLQINYDHMNLIHQWRRR
IGQTDSMAVEYIYDIDSNMVDVLVEGKSAWKYGYDANGNINKITDDGITKEMEFDVGDRI
TRFGEMRYKFDEDGFVAQRGFEHLSFNSRGQLVTVSNTRKYKYSYFYDPQGRLSVQRDKY
GKVMQYFYANVLSPHQITHTYNHTSGEMTQYLYDSHGTLIALERKGNTYYIATDPNGSPL
VIFDSRGYVVKQCSYDPLGLQESDTNPNFELSFGFQAMLYNSMTNIAFKNQRPYDTLSGH
WLSPDYENMFKKLDTANAEFVSKEINMQSSRKPTTTVDYTYLHDWLNVLGFDIYSLAPEV
DYTGDLHPDNCQRDHQLLPSSSAFECTFKRDMKNLLTLTTVPRSKITPLQSLAKQRPSPF
TSIFGEGVTVSIINHKVHINKADIATELSRKIASVLLNGSEAVDLPFTIRGKDVHYFVKN
SYADSDNDLRTLGIHSNLVTFENGINISVQRGGHGHRSAFSHEVADVRIHGNNSVINIRY
GTTIDKERSRILFHAKERAIKQLWNSEKYLLKNSLPSHYKWTEQEIRELVSGGQVQGYEG
QYIRDPQNYPELADDSNNIRLIQD
Download sequence
Identical sequences V4B1C8
jgi|Lotgi1|91191|gw1.16.482.1 XP_009049293.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]