SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|92097|gw1.57.262.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|92097|gw1.57.262.1
Domain Number 1 Region: 294-425
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 421-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000368
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 459-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000124
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 4 Region: 497-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000075
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 263-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000105
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|92097|gw1.57.262.1
Sequence length 538
Sequence
VKALGTFELKLTSFLNAHGLNSDGNCCNGLRTAGVCSSSCKTFFRVCLTHYQSEISNNPE
CTFGSKTTSVLGNNTIQFNKDTASQEFKNPVQFEFQFSWPGSFSLIIEAWHDSTLHGSPR
ELIARVAVQRSAEVGKDWYTFKHDTPYSEINYSYRIICGEYYYGAGCSEFCRPRDDQFGH
YKCSTNGTKICLDGWSGDMCEEAMCLPGCHPDHGYCDNPNECRCRLGWQGNFCDACINYP
GCQHGSCSKPWQCNCEEGWGGLFCNQDLNYCTHHKPCKNAGTCTNTGEGSYTCTCPPGFS
GTNCEIEYDDCERRPCLNGGSCKDIGIGYRCQCESGFYGKSCEHEADSCKTNPCINGGTC
TEDEASYTCQCDAGYTGLNCEIEINECDQHPCKNGGRCIDQRNGFRCVCSTGFEGPTCSD
NINDCVHDPCQNGGTCLDLINDYECRCRAGFIGPLCEINVDDCETRPCANGGICSDLDND
FKCHCADGFAGKDCRININDCADIPCRHGGNCTDLVDDYSCDCPEGFWGKRCHLYEGM
Download sequence
Identical sequences V3Z9X6
XP_009061666.1.39240 jgi|Lotgi1|92097|gw1.57.262.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]