SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|96385|gw1.9.516.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|96385|gw1.9.516.1
Domain Number 1 Region: 49-148
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.09e-28
Family Canonical RBD 0.002
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|96385|gw1.9.516.1
Domain Number - Region: 9-49
Classification Level Classification E-value
Superfamily Prefoldin 0.0602
Family Prefoldin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|96385|gw1.9.516.1
Sequence length 150
Sequence
ELEAIKARVKEMEEEAEKLKEMQSEVEKQMNMSSSSVCKFNLTFPTIEEKVDADSKSVYV
GNVDYAATAEELEQHFHGCGSINRVTILCDKFTGHPKGFAYVEFADKDSITTAMALDDSL
FRGRQIKVSPKRTNRPGISSTNRPPRRARG
Download sequence
Identical sequences V3YX95
jgi|Lotgi1|96385|gw1.9.516.1 XP_009066493.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]