SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|104487|e_gw1.3.538.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|104487|e_gw1.3.538.1
Domain Number 1 Region: 3234-3358
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-33
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 3842-4025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-32
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 3 Region: 2294-2416
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.00083
Further Details:      
 
Domain Number 4 Region: 941-1053
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 3137-3239
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-27
Family Cadherin 0.003
Further Details:      
 
Domain Number 6 Region: 1577-1678
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 837-945
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-26
Family Cadherin 0.00071
Further Details:      
 
Domain Number 8 Region: 3345-3457
Classification Level Classification E-value
Superfamily Cadherin-like 4e-26
Family Cadherin 0.00074
Further Details:      
 
Domain Number 9 Region: 1159-1270
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 2930-3038
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 1465-1575
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-25
Family Cadherin 0.00067
Further Details:      
 
Domain Number 12 Region: 1045-1176
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 480-592
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.00069
Further Details:      
 
Domain Number 14 Region: 1780-1900
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 737-849
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 16 Region: 2510-2618
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 17 Region: 2606-2733
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 18 Region: 142-263
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.003
Further Details:      
 
Domain Number 19 Region: 3032-3142
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2824-2928
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 366-486
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 22 Region: 3445-3569
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 23 Region: 2200-2305
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 24 Region: 2096-2196
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-19
Family Cadherin 0.0015
Further Details:      
 
Domain Number 25 Region: 1373-1477
Classification Level Classification E-value
Superfamily Cadherin-like 2e-18
Family Cadherin 0.0053
Further Details:      
 
Domain Number 26 Region: 1258-1367
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 27 Region: 2408-2516
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-17
Family Cadherin 0.0041
Further Details:      
 
Domain Number 28 Region: 1888-2013
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-16
Family Cadherin 0.0039
Further Details:      
 
Domain Number 29 Region: 1682-1797
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.004
Further Details:      
 
Domain Number 30 Region: 2720-2830
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0014
Further Details:      
 
Domain Number 31 Region: 585-679
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000814
Family Cadherin 0.0019
Further Details:      
 
Domain Number 32 Region: 1999-2102
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000457
Family Cadherin 0.0039
Further Details:      
 
Domain Number 33 Region: 280-372
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000485
Family Cadherin 0.0022
Further Details:      
 
Domain Number 34 Region: 4164-4203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.017
Further Details:      
 
Domain Number 35 Region: 4053-4089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000189
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 36 Region: 3560-3651
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000006
Family Cadherin 0.0071
Further Details:      
 
Domain Number 37 Region: 4128-4168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000571
Family EGF-type module 0.017
Further Details:      
 
Domain Number 38 Region: 32-154
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000714
Family Cadherin 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|104487|e_gw1.3.538.1
Domain Number - Region: 4087-4125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000249
Family EGF-type module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|104487|e_gw1.3.538.1
Sequence length 4389
Sequence
MEIASLCLWLWWLCLPFTCSAQYSPLNKDNFNFTKSLYNVSIAENSIANTYVTSFEKMGI
PILTANPEYLQIEYRIEGDGNNIFKAEEHFEGDFCFLRIRTSTVSFRSVINREARSSYSL
RVVATASYSFGNQLHTSADLIVNVLDENDLSPLFDKNFYSVQVPEDTPLHSSIAQVSASD
ADIGINGEVYFRLAKRTNKFAIHPTSGVVTLTHKLKYSYQTIYEVNVLASDRGPKFPNGP
KPTVKTLLKITVTAVNYQSPTVKVHHHPSIVEHGHYGSIYAILMVSDSDDGKNGHINSVD
IVDGDPENRFRIVQGKEINLYNIEILSSLDRETSPYGYNLTIQATDKGNPPKTSTTNVHV
QIQDTNDNEPKFKQNSYQTSISEVVPVNTPVIIINALDNDWGKNSEIIYSIVAGNTDGLF
KIDEYSGLITTNAPLDADFIAGVNRSNTTIVLTVHAEDQANSGTRKFSETKVKIVILDYN
DNSPTFDQKTFTGEIDENEPEGISVLRVVARDIDAGDNGTIIYSIPDAQSVPFDIDQFSG
VITTNTRLDFEQMQSEYNIRVRASDMGLPYRREVETTVTIKLKNVNDNHPEFEVVDCSGT
ISREAKEGTLITVVTAIDMDIGDVVSYRIIGGNEHNCFRIEPSSGAITLRCDLLSYPNDS
LSLMVAATDDKHISKPTTINMTLIHNKPLPGTSQDIRITCSETDVRMRLAENYKLQTAFT
NNKLNEVSTTSGTPAANNHAPVFKPNTPDYIEVPEDQTIGSQIKLFQADDQDIGYNGRLV
YGIANGNKKGAFDIDTFTGALKLMSSLDRETTATYTLVISVSDLGSPHKNSSTNLRIVVT
DVNDNRPTFEKDTYEVNISEDQHVNTTVISIMARDMDQGHNAKIHYSILTDTDDFNIDTS
GGIIRVNRPLDRETQNSYKLIVQAKDSGREVQLASQTIVTINLVDVNDNRPKFIPPTYFV
KVREDLPVGALVTILTAEDLDSGKNGELTYSLTLGADDKFEIDANTGVIRIAGRLDYEEK
QLYNISALAEDGGIPPLASACLVNIEIVDVNENFSPPLFDSFIAKGYVDENGKVGTFVMN
VLAKDPDSLPNEDNAIIYSIRDGSGLGRFTIDNNGTIRTTQVLDRETASHYWLAVYAQDR
SLVPRSSRLEVLITVLDVNDNVPHSLQPGYYTSVSERESNQDIVTIQAMDDDQNPNQQLH
FKITGGNPQSFFKINPQSGLISTTDRELDRETQDEHALEITISDNGRPNLQSTTRVIVKV
TDVNDNKPRFLTFFKDAYVRILETSNSNSRPIYRVVAFDKDDGPNSFITYSIVKPNNSPF
SVDSSTGNIYAISSLDPRRDYVLQVRATDHGSPPRKSQTKIRFSVLKRPRSSQHAPYFDA
KNYSAIITENDVVGEYIIMDVTATDDNDDIWYFIDGGNENHTFAILPSTGSLLLARKVDR
EKQASYDLGVCATDGIHTNCTWVHIRVIDINDNEPVFSQDTYIAEISENADIGQSVVQLS
ATDADEDNRVFFTIRSSVNLVSQKLFEIDERQGIIKVAQPLDREVLSRHVLTVMVNDLGT
PSKRSFARVKITVLDDNDHNPVFLSPVFSGRVYETSAVGTSVVQLIATDRDKGDNAEITY
SLVAGNAGGTFGLDSKLGLITVVKELDRHNQDGYSLEVAATDHGTPPRSSTAMVNIDVTI
SDNSPPKFSKLEYMAEMKENRPVGTIVLALQASSQSSLVYQILPCLAEEFFLVNPNSGVI
STRKEIDFEEHKFFNFTVKATNIVEASSEVAVVIHITDANDNHPVFLHEIYNGHIRESDP
TNSFVLDENNSPLVIQAKDEDYDANALLHYEIIDLNAQEYFLIDANTGTLRTKTTLDHET
ISNFNFSIQVYDGGKPSLNALKPATVIINVIDVNDSPPRFPTHTHKAKVLLPTYKDITVI
ELKASDPDGNKNEALTYSIMGGNEGNKFTIDSKTGVITIQDESNMKPSYYLRVMVTDGKF
QTSADISITVEKTVDYGLRFTEDQYIVYVEENSKKVDRLLVVQPVGHSINEHLTFKLLNN
KNMFSVGQTSGVLYTKGVPFDRELNNNYTVVVSVEDSRQPPRYAHVVISVIVNDLNDNVP
MFINQPYYSAVSVESKAGDVIKQVTAIDKDFGENGRITYSLIPTSHDKFDINQYTGEIVV
KQLTIDDENSVVMLDVEAKDHGDPFYSARAQVPINIVSSYSPMFDKQFYNVTVPENVVLY
TPVTSIHAVSPTNQKLIYSISDGNHDEDFAVDFNTGLMSVMGELDYENKKQDTLTLRATD
VTSGNYAETRVHLHIKDINDNEPIFTSMTYTEAVSEALAVGSTILKLTATDADAGMNQMI
SYSLAPNQVDNNDMEYFHVNFETGDLFLQKKLDCEAQTSYQFLAVATDGGMPALSSTALV
HLMVLDTNDNAPQFFQTSFDCSITDQAQRGQLVTRLLATDADSSDVNNLSYMIIGGNEKQ
TFSIDSASGLVSISGQRKPVFQPVHSLNISVTDGVYTSYTRLTVSVQNSNRHTPQFSQTK
YEAEFYENQAPGSLVGTVSADDEDRGGYGLLTYSITSDIMQEFFQIDADTEVLSMKVLDR
EEQERYTIPIAATDNGGKMNFTTLYVTIKDLNDNLPSFKIKEYKSNVYYNAAVGTEILKI
EGDDLDDGENGKILYSIYQEEDPDVNTIFAINSNTGSLSVNSSLADKENAVYQFFVRAKD
SGDIPLENHVPVEILIMGPDENPPSFDQDRYAYFISENAEVGTTIATIKADGEGPLMYSI
VSGVTEATNSPPKFTINNSGQLKIIEALDRESVDTFMLTIRASTQTSPALVANAKVVIKL
KDVNDNSPVFDSDPYIITLVENTPAGASLIQVQAEDKDEESLLEYKLGADMEEEANIFNL
DPESGWITLLTSVDREEREEFNITVVVYDKNLGITQSATSSVSVTVTDFNDNSPEFNRNH
YSTSVNEDAELDIIFLSVTATDVDIGQNSEISYYITHGDKEGHFDINRNGDLFVSKRSLD
RESKKHYRLTIAATDGAYVSYATVDIDILDANDNSPQCSKLMYTIFEKEDVPVGKRLEFI
EATDQDDPATRNSRLEYQLLGIGAESFYLDRTTGILTTAIELDRETQSKYNLIASAIDGG
GLSCTSEVNIYISDINDNAPVFTLTENTFSIQEDARINTLVTRVTATDKDLGINKKIVYG
IMGDSKSTFSIDSNSGIISLISPLDREITSQHIITVTAKNLGPTPLFNSTELRILVLDVN
DNKPEFERTSYYVEVPEDTKLQSTVITVKASSLDIGQNANITYSIMAGNEQNKFKIDPNN
GAVIVQEPLDFELSREYFLTILAKDHGEPPLSNSAIVNINITDINDNKPRFSPSSYYTVS
VKEDLKLHEEIIKVLATDEDGENNNKLTYLIQSGDVYGQFHINKDNGSLTVVKSLDREMM
DTYVLQIDVRDSGQPVLSNSAAVNIKILDANDNPPLFSERNYTAYIQEGSKAGINILKLS
ATDDDLEENGGPFLFDIVNGNENKEFHINKDGVILTSGGDLKKKVKESYQLTVRAFDRGS
PVLFSDVVVDINVVDESMYPPQVRNLTIAISSYLGKTMKGVIGKVNAFDSDPYDILNYRI
VSANDHLFDVHPIDGRIIAKSGLDAGSYKVNVSVTDGRFNSYSIVTVEVMEISEEMMDSS
VTIQFKEMFPEQFYANYLKDFQKILKRELNVRAKDVEILNVQPSDESIINRSRRRRSLSS
NLDVLFVVRKVTGKLFNKNSLRRKVERARDAIETGLNVEVEKVFNDICTKSMCDSGPCVS
HLVFDDTDLEPVTVGADSYVSARHRYIFFCNCSDGSCNGVVCGDKRCSANQICHRNNNRY
SCRCPSGKTGSKCQDNVYSPSTICRNQPMTFNGKSFARWTLTETTEKRLTLSLRFRTRKP
SCNVMYTTGQVDYSILEIKDSNIQYRFNCGSGEGFVKIPVDVSDGQWHLIMLERNGRTAE
LFLDQGYKAISSAPGTNDELNLDSFDVYFGAEVEVFPEGYNDIKRGFEGCMEGIRMFNIL
LPFTGTNRIAISQKFEDVEFKCKDYATLPTTGNICGRHPCMNGGTCQYRQINSYFCQCMP
RYQGIRCEIDNDPCQDNPCFNQDKDVINGYTCICPGELKGKQCKYGKFCQPDTCKNGGVC
IEGPNSPLCHCLSKYQGLYCEKMVDPCVINPCYGGGTCISNNNNYRCECTKDRIGRHCED
NVSVAASIKIPVMLIYIIIVVGVIAIVILIIIICCVCKRRRKNRRRSHDAHNSNELNRML
PEDKKRSNKKLNEEILLSNYPKNPPPVPDRPVSYTPSNHDSMNTLNNFDNVRNYGSAADE
LERSGVHNIPSFCPADVYTHRFGTPPAAKHYYSTFQSPPSNPQSDTDSIQKDPQEYEYPT
NFLENYSGK
Download sequence
Identical sequences V4AFX8
jgi|Lotgi1|104487|e_gw1.3.538.1 XP_009055664.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]