SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|109908|e_gw1.11.685.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|109908|e_gw1.11.685.1
Domain Number 1 Region: 91-201
Classification Level Classification E-value
Superfamily EF-hand 9.67e-30
Family Osteonectin 0.0024
Further Details:      
 
Domain Number 2 Region: 26-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000929
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|109908|e_gw1.11.685.1
Domain Number - Region: 3-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family Follistatin (FS) module N-terminal domain, FS-N 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|109908|e_gw1.11.685.1
Sequence length 206
Sequence
ITDPCEKKRCRRGEQCIVDEKRQPSCVCYQNCEEETDERYWVCSTKNITYKSDCLLDREH
CLCRRKDAACKNLAEKKVHLDYYGGCRDLTACPKDEFQEFPNRLREWLFIVMKQLAAREE
LHEYLDLLESAKSDANHTDALVWKFCDLDQNPQDRRVSRRELQHTIQSLKAMEHCLVPFL
NDCDANNDRRITLREWGGCLNADLSK
Download sequence
Identical sequences V4B950
XP_009045318.1.39240 jgi|Lotgi1|109908|e_gw1.11.685.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]