SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|111197|e_gw1.12.239.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|111197|e_gw1.12.239.1
Domain Number 1 Region: 20-48,93-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-21
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 198-309
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-19
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|111197|e_gw1.12.239.1
Sequence length 411
Sequence
MTRPKRKGCCTVIHPREDNARFILLAVVMVIYMAVGASIFMVLERDNEKKEKADYDAHVA
EFKRKYPQINDTDLEALLALHSKAEAAGFVGNRRDRWDWPGSFYFVGTVVSTIGFGMTTP
RTVGGKIVLIFYGFFGCAGAILFFNLFLERIITFLAYILRAIHIRDLKRKGLITENKKEK
GRRSSQTSDDELDAWKPSVYWVMLILLLGALVVALCASAMYQPVEDWTYFEAIYFCFVTF
ATIGFGDLVVSQKESYPNVHLYRFANFIFIVIGCCCIYSLFNVTSIVIKQVLNWILRRLE
CRCRVRVPNPGRRNAITPGHLTKGGKPPSVTVTDVDGDSDSEYRRNSGEMISMKDFLQAN
KISLAMMQKELYETSQRGHSHKRQNGLQGGVGPMAILNRKLGQDDHFDSRV
Download sequence
Identical sequences V4BAV2
XP_009046567.1.39240 jgi|Lotgi1|111197|e_gw1.12.239.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]