SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|115879|e_gw1.22.140.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|115879|e_gw1.22.140.1
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 2 Region: 264-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000007
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 78-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000245
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 412-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000542
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 37-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000619
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 7 Region: 150-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000911
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 511-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 339-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 461-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 188-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000367
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 301-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000369
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 226-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 14 Region: 378-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000163
Family EGF-type module 0.037
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|115879|e_gw1.22.140.1
Domain Number - Region: 552-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|115879|e_gw1.22.140.1
Sequence length 585
Sequence
DDCKSQPCSNNGTCIDLIGDFTCTCPQGLTGKKCDSDIDECAENPSLCRNGGTCKNTPGS
YTCSCKTGFSGRNCETGQDACFSEPCKNGARCVAGRNSYSCDCLPGFSGQNCSQTSCTLN
PCANGGTCLVNGNGYFCSCPKGFTGDNCQLTPCDPSPCTNGGSCMVTQDSYFCRCPLGTA
GINCEIKPNPCASAPCQHGGQCLDGQFAGYKCRCPEGFNGINCQVVDRCFPNPCQNGAAC
FSGLTTFSCQCLRGFTGKTCNARIDQCTSNPCNNGGECVTKSTGYYCNCAPGFTGTNCNV
FTPCSSAPCENNGICSPIDNGYFCSCKQGFRGSNCEIFDPCNQNPCENGGRCSAFEDGFQ
CSCRAGFSGQFCQVASGCTLNPCSGGSTCIPVGSAGYRCQCPVGLRGRKCDQIDICATRP
CENDGVCYASSRASKGYSCQCLRGFTGANCETRVISVLESKCSEKPCLHNGECVINSQVP
EGFVCRCKEGFEGSRCESLAPTPLPTPGTTGACLALPCQNGGSCVNQGTSYRCNCINGYG
GTNCASAIKTCPLRCKNTGVCFFDERGEPRCRCPNAASGMRCGRY
Download sequence
Identical sequences V4AHY0
jgi|Lotgi1|115879|e_gw1.22.140.1 XP_009052865.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]