SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|119662|e_gw1.31.194.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|119662|e_gw1.31.194.1
Domain Number 1 Region: 27-215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000018
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 2 Region: 235-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000699
Family EGF-type module 0.043
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|119662|e_gw1.31.194.1
Domain Number - Region: 273-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|119662|e_gw1.31.194.1
Sequence length 346
Sequence
MFFCELKDNDFKIVVYCFVIVNCPEGYYLDNNECLPCDIGQYTDEEKQTTCKQCPVDMTT
GSLASTNISQCYSLCDVGHYYESISSNCIKCNIGEYQDQSGQTQCKSCPIGETTKDIGST
SITDYLCKLGEELSVTGECVKCPKGSYRDDLDQEYCQACPYGWSTSDVGSTSISQCTVAH
CQRGEYLNEDNTCELCEKGTYQPNRGQTSCIACGRGLTTSDKGSTSHDDCRPGPIDECRL
DLDDCDDDAECLDEEDGFSCVCNFGFTGNLNGSVCIDNCDNRCDIHGQCHYYNNGNSFCS
CQDGYQGDRCDQIEGKLTLYKEYFFVKNFIHFSFIIYCLFCKSFPK
Download sequence
Identical sequences V4A9H7
XP_009056080.1.39240 jgi|Lotgi1|119662|e_gw1.31.194.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]