SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|120690|e_gw1.34.291.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|120690|e_gw1.34.291.1
Domain Number 1 Region: 367-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-83
Family Protein kinases, catalytic subunit 0.00000000744
Further Details:      
 
Domain Number 2 Region: 819-953
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.4e-47
Family FAT domain of focal adhesion kinase 0.0000152
Further Details:      
 
Domain Number 3 Region: 97-213
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-41
Family Second domain of FERM 0.000026
Further Details:      
 
Domain Number 4 Region: 220-325
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-33
Family Third domain of FERM 0.0000456
Further Details:      
 
Domain Number 5 Region: 3-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.8e-29
Family First domain of FERM 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|120690|e_gw1.34.291.1
Sequence length 955
Sequence
MDRSILKVHLPNGGFNMVKYGDATDIKDIIKLVVGRLAAGVRFYSKCYALKLVHTQSRGE
SYWLHNDLTMYQVRQKYEAKHPPEEWRTELRVRYLPKNFQDLYAKDKVTFYYLYDQIRND
YMKDIAEHIDHDVAVRLACIEMRRFFKDMPQVALDKKSNFDYLEKEVGLKRFLPKTVIDT
MKSKQLRKLIQHHFRQYAQLTESECVYKFFETLFIVSKFNQERFKCALGSGWSIYVEIVV
GPECGISYLTEKASSPTHMADFAQVQSIQTVGSEDGKGILQLKIAGANEPLMITCVTLDI
AEDMADLIDGYCRLVHDMQGSLWSRKACLPYDPQTRHAGHFHCMKQTFSLRISDYAEIVE
DEGDYSTPDAKDYEIIRDAIRLVEILGEGQFGDVYKGIFVDKEKQQVPVAVKTCKEDNEE
SMTEKFLEEAYIMQQFDHPHIVKLIGICSEVRPVWIVMELARHGEMRAYLQSNKPRLDLV
TLIMYAYQLSTALSYLESKKFVHRDIAARNVLVSAHDCVKLGDFGLSRWVEEQCYYKASK
GKLPIKWMAPESINFRRFTAASDVWMFGVCIWEILMYGVKPFQGVKNNDVIGKIENGERL
PLPIDCPPSLYNLMCACWQYEPSKRPSFADLKTWLYEIVDEERLRQEEEMHRGNRRVQAI
SWGSNGSDEDPPPKPARPIYPNGTSGNNSLNSSIASIPNQWNNSASTPLGHSTPASGPSP
NVDEDIRPHSHITEIDEKLIAERLRQQQRDSEMDSKWLQSEEKNLKFATHMVQGDDDNDS
TKENSPPPSAQYQFRHAPVRIASQSSSNESNELNQLARSTNDIDRTNDGVYDSTTSVVRS
VMTMTKEAQTGKAGEYVEFVKKVGLDLRGLLANVDAVLTKLPSDKHREIQMAQKVLSTDM
ATLISTMKLAQQYSKTTMDVEYRKGMLKAAHVLAMDSKNLLDVVDSARLESGVFS
Download sequence
Identical sequences V3ZMB0
jgi|Lotgi1|120690|e_gw1.34.291.1 XP_009056648.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]